UniProtKB/Swiss-Prot O75923: Variant p.Arg1581His

Dysferlin
Gene: DYSF
Feedback?

Variant information Variant position:

1581 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Histidine (H) at position 1581 (R1581H, p.Arg1581His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs185596534 [ dbSNP | Ensembl ]

Sequence information Variant position:

1581 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2080 The length of the canonical sequence.
Location on the sequence:

PMPPRQFHQLAAQGPQECLV R IYIVRAFGLQPKDPNGKCDP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDP

Mouse                         PMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDP

Bovine                        PLPPRQFHQLASQGPQECLVRVYIIRAFGLQPKDPNGKCDP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2080	Dysferlin
Topological domain	1 – 2046	Cytoplasmic
Domain	1561 – 1679	C2 6
Binding site	1594 – 1594
Binding site	1600 – 1600

Literature citations
Dysferlin mutations in Japanese Miyoshi myopathy: relationship to phenotype.
Takahashi T.; Aoki M.; Tateyama M.; Kondo E.; Mizuno T.; Onodera Y.; Takano R.; Kawai H.; Kamakura K.; Mochizuki H.; Shizuka-Ikeda M.; Nakagawa M.; Yoshida Y.; Akanuma J.; Hoshino K.; Saito H.; Nishizawa M.; Kato S.; Saito K.; Miyachi T.; Yamashita H.; Kawai M.; Matsumura T.; Kuzuhara S.; Ibi T.; Sahashi K.; Nakai H.; Kohnosu T.; Nonaka I.; Arahata K.; Brown R.H. Jr.; Saito H.; Itoyama Y.;
Neurology 60:1799-1804(2003)
Cited for: VARIANTS MMD1 CYS-999 AND GLU-1679; VARIANT HIS-1581;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.