UniProtKB/SwissProt variant VAR

Variant information

Variant position:

609

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Glycine (G) to Arginine (R) at position 609 (G609R, p.Gly609Arg).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from glycine (G) to large size and basic (R)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Renal tubular acidosis, distal, autosomal dominant (AD-dRTA) [MIM:179800]: An autosomal dominant disease characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis. It is due to functional failure of alpha-intercalated cells of the cortical collecting duct of the distal nephron, where vectorial proton transport is required for urinary acidification. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In AD-dRTA; detected subapically and at the apical membrane as well as at the basolateral membrane in contrast to the normal basolateral appearance of wild-type protein.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs878853002 [ dbSNP | Ensembl ]

Sequence information

Variant position:

609

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

911

The length of the canonical sequence.

Location on the sequence:

RKFKNSSYFPGKLRRVIGDF G VPISILIMVLVDFFIQDTYT

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYT

Mouse                         RKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYT

Rat                           RKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDTFIKNTYT

Chicken                       RQFKNSVFLPGKVRRLIGDFGVPISIFVMALADFFIKDTYT

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 911	Band 3 anion transport protein
Transmembrane	603 – 623	Helical; Name=7
Region	559 – 630	Involved in anion transport
Site	590 – 590	Important for anion transport
Helix	609 – 623

Literature citations

A novel missense mutation in AE1 causing autosomal dominant distal renal tubular acidosis retains normal transport function but is mistargeted in polarized epithelial cells.
Rungroj N.; Devonald M.A.J.; Cuthbert A.W.; Reimann F.; Akkarapatumwong V.; Yenchitsomanus P.-T.; Bennett W.M.; Karet F.E.;
J. Biol. Chem. 279:13833-13838(2004)
Cited for: VARIANT AD-DRTA ARG-609; FUNCTION; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANT AD-DRTA ARG-609;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02730: Variant p.Gly609Arg