Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O75603: Variant p.Arg47Leu

Chorion-specific transcription factor GCMb
Gene: GCM2
Feedback?
Variant information Variant position: help 47 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Leucine (L) at position 47 (R47L, p.Arg47Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In FIH2; abolishes normal DNA binding ability of the protein. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 47 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 506 The length of the canonical sequence.
Location on the sequence: help QMPQELALFDQFREWPDGYV R FIYSSDEKKAQRHLSGWAMR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         QMPQELAL-FDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMR

Mouse                         QMPQEPTH-FDHFREWPDGYVRFIYSSQEKKAQRHLSGWAM

Drosophila                    IVPHVPDQEFDEFNEWSDGHVRHIYSLHNEEAKKHISGWAM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 506 Chorion-specific transcription factor GCMb
DNA binding 19 – 174 GCM



Literature citations
Identification of a novel mutation disrupting the DNA binding activity of GCM2 in autosomal recessive familial isolated hypoparathyroidism.
Baumber L.; Tufarelli C.; Patel S.; King P.; Johnson C.A.; Maher E.R.; Trembath R.C.;
J. Med. Genet. 42:443-448(2005)
Cited for: VARIANT FIH2 LEU-47; CHARACTERIZATION OF VARIANT FIH2 LEU-47; Identification and characterization of novel parathyroid-specific transcription factor Glial Cells Missing Homolog B (GCMB) mutations in eight families with autosomal recessive hypoparathyroidism.
Bowl M.R.; Mirczuk S.M.; Grigorieva I.V.; Piret S.E.; Cranston T.; Southam L.; Allgrove J.; Bahl S.; Brain C.; Loughlin J.; Mughal Z.; Ryan F.; Shaw N.; Thakker Y.V.; Tiosano D.; Nesbit M.A.; Thakker R.V.;
Hum. Mol. Genet. 19:2028-2038(2010)
Cited for: VARIANTS FIH2 LEU-47 AND TRP-110; VARIANT ASP-282; CHARACTERIZATION OF VARIANTS FIH2 LEU-47 AND TRP-110; SUBCELLULAR LOCATION; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.