Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41180: Variant p.Arg465Gln

Extracellular calcium-sensing receptor
Gene: CASR
Feedback?
Variant information Variant position: help 465 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glutamine (Q) at position 465 (R465Q, p.Arg465Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HHC1; loss-of-function mutation; the quantity of the mutant receptor is higher than that of the wild-type receptor; dose-response curves show that the mutation significantly reduces the sensitivity of the receptor to extracellular calcium concentrations. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 465 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1078 The length of the canonical sequence.
Location on the sequence: help TNGSCADIKKVEAWQVLKHL R HLNFTNNMGEQVTFDECGDL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         TNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDL

Mouse                         TNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDL

Rat                           TNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDL

Pig                           TNGSCADIKKVEAWQVLKHLRHLNFTSNMGEQVTFDEYGDL

Bovine                        TNGSCADIKKVEAWQVLKHLRHLNFTSNMGEQVTFDECGDL
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 20 – 1078 Extracellular calcium-sensing receptor
Topological domain 20 – 612 Extracellular
Site 482 – 482 Important for ability of agonist AMG 416 to activate G-protein-coupled receptor activity
Glycosylation 446 – 446 N-linked (GlcNAc...) asparagine
Glycosylation 468 – 468 N-linked (GlcNAc...) asparagine
Disulfide bond 236 – 561
Mutagenesis 458 – 458 W -> A. Decreased G-protein coupled receptor signaling pathway.
Mutagenesis 482 – 482 C -> SY. Abolishes ability of agonist AMG 416 to activate G-protein-coupled receptor activity.
Helix 457 – 465



Literature citations
Identification of a novel inactivating R465Q mutation of the calcium-sensing receptor.
Leech C.; Lohse P.; Stanojevic V.; Lechner A.; Goeke B.; Spitzweg C.;
Biochem. Biophys. Res. Commun. 342:996-1002(2006)
Cited for: VARIANT HHC1 GLN-465; CHARACTERIZATION OF VARIANT HHC1 GLN-465; VARIANT SER-986;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.