UniProtKB/SwissProt variant VAR

Variant information

Variant position:

447

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Proline (P) to Leucine (L) at position 447 (P447L, p.Pro447Leu).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic.

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-3

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Ceroid lipofuscinosis, neuronal, 7 (CLN7) [MIM:610951]: A form of neuronal ceroid lipofuscinosis with onset in early childhood. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. The lipopigment patterns observed most often in neuronal ceroid lipofuscinosis type 7 comprise mixed combinations of granular, curvilinear, fingerprint, and rectilinear profiles. {ECO:0000269|PubMed:17564970, ECO:0000269|PubMed:18850119, ECO:0000269|PubMed:19177532, ECO:0000269|PubMed:19201763, ECO:0000269|PubMed:19277732, ECO:0000269|PubMed:21990111, ECO:0000269|PubMed:22612257}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In CLN7.

Any additional useful information about the variant.

Sequence information

Variant position:

447

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

518

The length of the canonical sequence.

Location on the sequence:

GLGYPVCNLMSYTLYSKILG P KPQGVYMGWLTASGSGARIL

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARIL

Mouse                         GTGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARIL

Xenopus laevis                GVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTL

Zebrafish                     GVGYPTCNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 518	Major facilitator superfamily domain-containing protein 8
Topological domain	434 – 451	Cytoplasmic
Alternative sequence	237 – 518	Missing. In isoform 2.

Literature citations

Mutations in MFSD8/CLN7 are a frequent cause of variant-late infantile neuronal ceroid lipofuscinosis.
Aiello C.; Terracciano A.; Simonati A.; Discepoli G.; Cannelli N.; Claps D.; Crow Y.J.; Bianchi M.; Kitzmuller C.; Longo D.; Tavoni A.; Franzoni E.; Tessa A.; Veneselli E.; Boldrini R.; Filocamo M.; Williams R.E.; Bertini E.S.; Biancheri R.; Carrozzo R.; Mole S.E.; Santorelli F.M.;
Hum. Mutat. 30:E530-E540(2009)
Cited for: VARIANTS CLN7 ARG-52; LYS-294; ASP-310 AND LEU-447;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8NHS3: Variant p.Pro447Leu