UniProtKB/SwissProt variant VAR

Variant information

Variant position:

241

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Proline (P) at position 241 (T241P, p.Thr241Pro).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (P)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In CFC1 and LPRD3.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs387906661 [ dbSNP | Ensembl ]

Sequence information

Variant position:

241

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

766

The length of the canonical sequence.

Location on the sequence:

ELHVEVLENVPLTTHNFVRK T FFTLAFCDFCRKLLFQGFRC

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRC

Mouse                         ELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRC

Chicken                       ELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRC

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 766	Serine/threonine-protein kinase B-raf
Zinc finger	234 – 280	Phorbol-ester/DAG-type
Binding site	235 – 235
Binding site	248 – 248
Binding site	251 – 251
Binding site	261 – 261

Literature citations

Mutation and phenotypic spectrum in patients with cardio-facio-cutaneous and Costello syndrome.
Schulz A.L.; Albrecht B.; Arici C.; van der Burgt I.; Buske A.; Gillessen-Kaesbach G.; Heller R.; Horn D.; Hubner C.A.; Korenke G.C.; Konig R.; Kress W.; Kruger G.; Meinecke P.; Mucke J.; Plecko B.; Rossier E.; Schinzel A.; Schulze A.; Seemanova E.; Seidel H.; Spranger S.; Tuysuz B.; Uhrig S.; Wieczorek D.; Kutsche K.; Zenker M.;
Clin. Genet. 73:62-70(2008)
Cited for: VARIANTS CFC1 PRO-241; PRO-244; PRO-246; ARG-257; LYS-262; SER-468; GLU-469; GLU-499; ASN-499; ASP-580; ASP-581 AND LEU-595;

Germline BRAF mutations in Noonan, LEOPARD, and cardiofaciocutaneous syndromes: molecular diversity and associated phenotypic spectrum.
Sarkozy A.; Carta C.; Moretti S.; Zampino G.; Digilio M.C.; Pantaleoni F.; Scioletti A.P.; Esposito G.; Cordeddu V.; Lepri F.; Petrangeli V.; Dentici M.L.; Mancini G.M.; Selicorni A.; Rossi C.; Mazzanti L.; Marino B.; Ferrero G.B.; Silengo M.C.; Memo L.; Stanzial F.; Faravelli F.; Stuppia L.; Puxeddu E.; Gelb B.D.; Dallapiccola B.; Tartaglia M.;
Hum. Mutat. 30:695-702(2009)
Cited for: VARIANT LPRD3 PRO-241; VARIANTS NS7 ARG-241; MET-241; CYS-531 AND VAL-597; VARIANTS CFC1 PHE-245; PRO-246; ARG-257; LYS-275; GLU-469; PHE-485; ASN-499; LYS-501; PRO-525; LEU-595; ARG-599; GLN-601; GLU-638 AND ARG-709;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P15056: Variant p.Thr241Pro