Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P29317: Variant p.Gly948Trp

Ephrin type-A receptor 2
Gene: EPHA2
Feedback?
Variant information Variant position: help 948 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Tryptophan (W) at position 948 (G948W, p.Gly948Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CTRCT6; reduced protein stability and reduced ability to stimulate cell migration in absence of its ephrin ligand. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 948 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 976 The length of the canonical sequence.
Location on the sequence: help AGYTAIEKVVQMTNDDIKRI G VRLPGHQKRIAYSLLGLKDQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         AGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQ

Mouse                         AGYTAIEKVVQMSNEDIKRIGVRLPGHQKRIAYSLLGLKDQ
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 24 – 976 Ephrin type-A receptor 2
Topological domain 559 – 976 Cytoplasmic
Domain 904 – 968 SAM
Region 886 – 976 Negatively regulates interaction with ARHGEF16
Modified residue 930 – 930 Phosphotyrosine
Alternative sequence 498 – 976 Missing. In isoform 2.



Literature citations
The EPHA2 gene is associated with cataracts linked to chromosome 1p.
Shiels A.; Bennett T.M.; Knopf H.L.S.; Maraini G.; Li A.; Jiao X.; Hejtmancik J.F.;
Mol. Vis. 14:2042-2055(2008)
Cited for: VARIANT CTRCT6 TRP-948; Human cataract mutations in EPHA2 SAM domain alter receptor stability and function.
Park J.E.; Son A.I.; Hua R.; Wang L.; Zhang X.; Zhou R.;
PLoS ONE 7:E36564-E36564(2012)
Cited for: CHARACTERIZATION OF VARIANTS CTRCT6 ILE-940 AND CTRCT6 TRP-948;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.