Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O95972: Variant p.Arg68Trp

Bone morphogenetic protein 15
Gene: BMP15
Feedback?
Variant information Variant position: help 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 68 (R68W, p.Arg68Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In POF4; leads to marked reduction of mature protein production; does not generate a complete recovery of wild-type activity in granulosa cell line transfected with defective mutant and with equal amount of wild-type protein. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 392 The length of the canonical sequence.
Location on the sequence: help LLEESPGEQPRKPRLLGHSL R YMLELYRRSADSHGHPRENR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LLEESPGEQPRK-PRLLGHSLRYMLELYRRSADSHGHPRENR

Mouse                         LAKEAPGKEMKQWPQ--GYPLRYMLKLYHRSADPHGHPREN

Bovine                        LLEEAPGKQQRK-PRILGHPLRYMLELYQRSADASGHPREN

Sheep                         LLEEAPGKQQRK-PRVLGHPLRYMLELYQRSADASGHPREN

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Propeptide 19 – 267
Glycosylation 87 – 87 N-linked (GlcNAc...) asparagine



Literature citations
Identification of new variants of human BMP15 gene in a large cohort of women with premature ovarian failure.
Di Pasquale E.; Rossetti R.; Marozzi A.; Bodega B.; Borgato S.; Cavallo L.; Einaudi S.; Radetti G.; Russo G.; Sacco M.; Wasniewska M.; Cole T.; Beck-Peccoz P.; Nelson L.M.; Persani L.;
J. Clin. Endocrinol. Metab. 91:1976-1979(2006)
Cited for: VARIANTS POF4 TRP-68; THR-180 AND CYS-235; VARIANT LEU-263 INS; BMP15 mutations associated with primary ovarian insufficiency cause a defective production of bioactive protein.
Rossetti R.; Di Pasquale E.; Marozzi A.; Bione S.; Toniolo D.; Grammatico P.; Nelson L.M.; Beck-Peccoz P.; Persani L.;
Hum. Mutat. 30:804-810(2009)
Cited for: VARIANTS POF4 TRP-68; HIS-138; PRO-148 AND THR-180; VARIANTS ARG-5 AND LEU-263 INS; CHARACTERIZATION OF VARIANTS POF4 TRP-68; HIS-138; PRO-148 AND THR-180; CHARACTERIZATION OF VARIANTS ARG-5 AND LEU-263 INS; CSNK2B splice site mutations in patients cause intellectual disability with or without myoclonic epilepsy.
Poirier K.; Hubert L.; Viot G.; Rio M.; Billuart P.; Besmond C.; Bienvenu T.;
Hum. Mutat. 38:932-941(2017)
Cited for: VARIANT TRP-68;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.