UniProtKB/Swiss-Prot Q13936 : Variant p.Pro1868Leu
Voltage-dependent L-type calcium channel subunit alpha-1C
Feedback ?
Variant information
Variant position:
1868
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
1868 (P1868L, p.Pro1868Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution).following page
Other resources:
Links to websites of interest for the variant.
Sequence information
Variant position:
1868
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
2221
The length of the canonical sequence.
Location on the sequence:
P MCEDLELRRDSGSAGTQAHC
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human PAIRVQEVAWKLSSNRERHVP MCEDLELRRDSGSAGTQAHC
Mouse PAVRVQEAAWKLSSKR----- --------------------
Rat PAVRVQEAAWKLSSKR----- --------------------
Rabbit PAVRAQEAAWKLSSKR----- --------------------
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 2221 Voltage-dependent L-type calcium channel subunit alpha-1C
Topological domain
1525 – 2221 Cytoplasmic
Alternative sequence
1864 – 1898 Missing. In isoform 11, isoform 12, isoform 13, isoform 14, isoform 15, isoform 17, isoform 19, isoform 20, isoform 21, isoform 22, isoform 23, isoform 24, isoform 25, isoform 26, isoform 27, isoform 29, isoform 30, isoform 31, isoform 32, isoform 35 and isoform 37.
Alternative sequence
1864 – 1897 ERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPS -> MHCCDMLDGGTFPPALGPRRAPPCLHQQLQGSLAGLREDTPCIVPGHASLCCSSRVGEWLPAGCTAPQHA. In isoform 2, isoform 18 and isoform 28.
Literature citations
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.
