UniProtKB/Swiss-Prot P24394: Variant p.Ile75Phe

Interleukin-4 receptor subunit alpha
Gene: IL4R
Feedback?

Variant information Variant position:

75 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Isoleucine (I) to Phenylalanine (F) at position 75 (I75F, p.Ile75Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (I) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Allelic variants in IL4RA are associated with a susceptibility to atopy, an immunological condition that can lead to clinical symptoms such as allergic rhinitis, sinusitis, asthma and eczema.Allelic variants in IL4RA are associated with cedar pollen sensitization. Individuals develop Japanese cedar pollinosis with increased exposure to cedar pollen. Japanese cedar pollinosis is a type I allergic disease with ocular and nasal symptoms that develop paroxysmally on contact with Japanese cedar pollen. These symptoms, which occur seasonally each year, are typical features of allergic rhinitis, such as sneezing, excessive nasal secretion, nasal congestion, and conjunctival itching. - Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs1805010 [ dbSNP | Ensembl ]

Sequence information Variant position:

75 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

825 The length of the canonical sequence.
Location on the sequence:

STELRLLYQLVFLLSEAHTC I PENNGGAGCVCHLLMDDVVS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         STELRLLYQLVFL-LSEA-HTCIPENNGGAGCVCHLLMDDVVS

Mouse                         SSQLCLHYRLMFFEFSEN-LTCIPRNSASTVCVCHMEMNRP

Rat                           SSQLLLDYRLLFE-FSEN-LTCTPKNSADTVCVCQMAIEEP

Pig                           SAEFRLSYQLKFF-NTENHTTCVPENRAGSVCVCHMLMESI

Horse                         SAQLRLSYQLNDE-FSDN-LTCIPENREDEVCVCRMLMDNI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	26 – 825	Interleukin-4 receptor subunit alpha
Topological domain	26 – 232	Extracellular
Site	64 – 64	Minor IL4 binding determinant
Site	66 – 66	Minor IL4 binding determinant
Site	92 – 92	Minor IL4 binding determinant
Site	94 – 94	Minor IL4 binding determinant
Disulfide bond	74 – 86
Mutagenesis	64 – 64	L -> A. 100-fold reduction in IL4 binding.
Mutagenesis	66 – 66	F -> A. 45-fold reduction in IL4 binding.
Mutagenesis	67 – 67	L -> A. No effect on IL4 binding.
Mutagenesis	68 – 68	L -> A. No effect on IL4 binding.
Mutagenesis	91 – 91	D -> A. Little effect on IL4 binding.
Mutagenesis	92 – 92	D -> A. 50-fold reduction in IL4 binding.
Mutagenesis	93 – 93	V -> A. Little effect on IL4 binding.
Mutagenesis	94 – 94	V -> A. 35-fold reduction in IL4 binding.
Mutagenesis	95 – 95	S -> A. No effect on IL4 binding.

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.