UniProtKB/Swiss-Prot Q86TP1: Variant p.Gly397Arg

Exopolyphosphatase PRUNE1
Gene: PRUNE1
Feedback?

Variant information Variant position:

397 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Arginine (R) at position 397 (G397R, p.Gly397Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs3738477 [ dbSNP | Ensembl ]

Sequence information Variant position:

397 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

453 The length of the canonical sequence.
Location on the sequence:

DVSREQVDKELDRASNSLIS G LSQDEEDPPLPPTPMNSLVD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVD

Mouse                         GMSREQVDKDLDKASNSLISGLSQDEEDPPLPPTPMNSLVD

Rat                           GMSREQADKELDKASNSLIAGLSQDDEDPPLPPTPMNSLVD

Bovine                        GVSREQVDKELDRAGNSLLSGLSQDEEEPPLPPTPMNSLVD

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 453	Exopolyphosphatase PRUNE1
Region	393 – 420	Essential for homodimerization
Region	395 – 421	Disordered
Modified residue	399 – 399	Phosphoserine
Modified residue	410 – 410	Phosphothreonine
Modified residue	414 – 414	Phosphoserine

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.