Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00337: Variant p.Ser546Pro

Sodium/nucleoside cotransporter 1
Gene: SLC28A1
Feedback?
Variant information Variant position: help 546 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Serine (S) to Proline (P) at position 546 (S546P, p.Ser546Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In URCTU; no effect on localization to the cell membrane; loss of pyrimidine- and adenosine-specific:sodium symporter activity; affects urinary excretion of uridine and cytidine. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 546 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 649 The length of the canonical sequence.
Location on the sequence: help ISVRAEVLTTFALCGFANFS S IGIMLGGLTSMVPQRKSDFS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         ISVRAEVLTTFALCGFANFSSIGIMLGGLTSMVPQRKSDFS

Mouse                         ISVRAEILTTYALCGFANFSSIGIMLGGLTSMVPQRRSDFS

Rat                           ISVRAEILTTYALCGFANFSSIGIMLGGLTSLVPQRRSDFS

Pig                           ISVRAEILTTYALCGFANFSSIGIMLGGLTSMVPQRKGDFS

Rabbit                        ISVRAEVITTFSLCGFANLSSIGITLGGLTSMVPHRKSDLS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 649 Sodium/nucleoside cotransporter 1
Transmembrane 535 – 558 Helical
Alternative sequence 176 – 649 Missing. In isoform 2.
Mutagenesis 546 – 546 S -> ACRT. No effect on localization to the apical plasma membrane. Loss of pyrimidine- and adenosine-specific:sodium symporter activity. Probably due to sodium uncoupling in the nucleoside translocation cycle.
Mutagenesis 546 – 546 Missing. Loss of pyrimidine- and adenosine-specific:sodium symporter activity.



Literature citations
Functional analysis of the human concentrative nucleoside transporter-1 variant hCNT1S546P provides insight into the sodium-binding pocket.
Cano-Soldado P.; Gorraitz E.; Errasti-Murugarren E.; Casado F.J.; Lostao M.P.; Pastor-Anglada M.;
Am. J. Physiol. 302:C257-C266(2012)
Cited for: FUNCTION; TRANSPORTER ACTIVITY; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANT URCTU PRO-546; MUTAGENESIS OF SER-546; Functional disruption of pyrimidine nucleoside transporter CNT1 results in a novel inborn error of metabolism with high excretion of uridine and cytidine.
Wevers R.A.; Christensen M.; Engelke U.F.H.; Geuer S.; Coene K.L.M.; Kwast J.T.; Lund A.M.; Vissers L.E.L.M.;
J. Inherit. Metab. Dis. 42:494-500(2019)
Cited for: INVOLVEMENT IN URCTU; VARIANT URCTU PRO-546;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.