Home  |  Contact

UniProtKB/Swiss-Prot O14746: Variant p.Arg979Trp

Telomerase reverse transcriptase
Gene: TERT
Variant information

Variant position:  979
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Tryptophan (W) at position 979 (R979W, p.Arg979Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In DKCA2; shortened telomeres but no effect on telomerase catalytic activity nor on binding to TERC.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  979
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1132
The length of the canonical sequence.

Location on the sequence:   TFNRGFKAGRNMRRKLFGVL  R LKCHSLFLDLQVNSLQTVCT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCT

                              TFSQGAKPGRNMRRKLLAVLRLKCCALFLDLQVNGIHTVYM

Mouse                         TFQSVFKAGKTMRNKLLSVLRLKCHGLFLDLQVNSLQTVCI

Rat                           TFQGVSRAGKTMRYKLLSVLRLKCHGLFLDLQVNSLQTVCI

Bovine                        TFTQGFKPGRNMRRKLLAVLQLKCHGLFLDLQVNSLQTVFT

Baker's yeast                 ------KSSKGIFRSLIALFNTRISYKTIDTNLNSTNTVLM

Fission yeast                 SVELTKHMGKSFFYKILRSSLASFAQVFIDITHNSKFNSCC

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1132 Telomerase reverse transcriptase
Region 936 – 1132 CTE
Alternative sequence 808 – 1132 Missing. In isoform 2 and isoform 4.
Helix 966 – 983


Literature citations

Mutations in the reverse transcriptase component of telomerase (TERT) in patients with bone marrow failure.
Vulliamy T.J.; Walne A.; Baskaradas A.; Mason P.J.; Marrone A.; Dokal I.;
Blood Cells Mol. Dis. 34:257-263(2005)
Cited for: VARIANT AA THR-202; VARIANTS DKCA2 TRP-979 AND LEU-1127; CHARACTERIZATION OF VARIANT AA THR-202; CHARACTERIZATION OF VARIANTS DKCA2 TRP-979 AND LEU-1127;

Functional characterization of natural telomerase mutations found in patients with hematologic disorders.
Xin Z.T.; Beauchamp A.D.; Calado R.T.; Bradford J.W.; Regal J.A.; Shenoy A.; Liang Y.; Lansdorp P.M.; Young N.S.; Ly H.;
Blood 109:524-532(2007)
Cited for: VARIANT AA ASN-570; CHARACTERIZATION OF VARIANTS ASN-570; ASP-682; ARG-721; MET-726; ASN-902; TRP-979 AND LEU-1127;

Telomere shortening and loss of self-renewal in dyskeratosis congenita induced pluripotent stem cells.
Batista L.F.; Pech M.F.; Zhong F.L.; Nguyen H.N.; Xie K.T.; Zaug A.J.; Crary S.M.; Choi J.; Sebastiano V.; Cherry A.; Giri N.; Wernig M.; Alter B.P.; Cech T.R.; Savage S.A.; Reijo Pera R.A.; Artandi S.E.;
Nature 474:399-402(2011)
Cited for: VARIANT DKCB4 SER-704; VARIANT DKCA2 TRP-979; CHARACTERIZATION OF VARIANT DKCB4 SER-704; CHARACTERIZATION OF VARIANT DKCA2 TRP-979; CATALYTIC ACTIVITY;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.