Home  |  Contact

UniProtKB/Swiss-Prot Q9Y5Y4: Variant p.Val204Ala

Prostaglandin D2 receptor 2
Gene: PTGDR2
Variant information

Variant position:  204
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Valine (V) to Alanine (A) at position 204 (V204A, p.Val204Ala).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (V) to small size and hydrophobic (A)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  204
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  395
The length of the canonical sequence.

Location on the sequence:   YNVLLLNPGPDRDATCNSRQ  V ALAVSKFLLAFLVPLAIIAS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIAS

Mouse                         YNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIAS

Rat                           YNMLLLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAIIAS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 395 Prostaglandin D2 receptor 2
Topological domain 169 – 210 Extracellular
Helix 195 – 213


Literature citations

Discovery of three novel orphan G-protein-coupled receptors.
Marchese A.; Sawzdargo M.; Nguyen T.; Cheng R.; Heng H.H.Q.; Nowak T.; Im D.-S.; Lynch K.R.; George S.R.; O'Dowd B.F.;
Genomics 56:12-21(1999)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ALA-204;

Selective expression of a novel surface molecule by human Th2 cells in vivo.
Nagata K.; Tanaka K.; Ogawa K.; Kemmotsu K.; Imai T.; Yoshie O.; Abe H.; Tada K.; Nakamura M.; Sugamura K.; Takano S.;
J. Immunol. 162:1278-1286(1999)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; TISSUE SPECIFICITY; VARIANT ALA-204;

Tissue expression and chromosomal organization of a novel G protein-coupled receptor.
Methner A.; Schroeder S.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT ALA-204;

cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org).
King M.M.; Aronstam R.S.; Sharma S.V.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT ALA-204;

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT ALA-204;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.