Home  |  Contact

UniProtKB/Swiss-Prot P19429: Variant p.Lys36Gln

Troponin I, cardiac muscle
Gene: TNNI3
Variant information

Variant position:  36
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Lysine (K) to Glutamine (Q) at position 36 (K36Q, p.Lys36Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (K) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cardiomyopathy, dilated 1FF (CMD1FF) [MIM:613286]: A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. {ECO:0000269|PubMed:19590045, ECO:0000269|PubMed:21846512}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CMD1FF.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  36
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  210
The length of the canonical sequence.

Location on the sequence:   PAPIRRRSSNYRAYATEPHA  K KKSKISASRKLQLKTLLLQI
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PAP------IRRRSSN-YRAYATEPHAKKKSKISASRKLQLKTLLLQI

                              PAP------IRRQSSANYRAYATEPHAKKKSKISASRKLQL

Mouse                         PAP------VRRRSSANYRAYATEPHAKKKSKISASRKLQL

Rat                           PAP------VRRRSSANYRAYATEPHAKKKSKISASRKLQL

Bovine                        PPP------VRRRSSANYRAYATEPHAKKKSKISASRKLQL

Rabbit                        PAP------VRRRSSANYRAYATEPHAKSKKKISASRKLQL

Cat                           PAP------VRRRSSANYRAYATEPHAKKKSKISASRKLQL

Horse                         PPP------VRRRSSANYRAYATEPHAKKKSKISASRKLQL

Xenopus laevis                PPPAAPPPLIRRRSSANYRSYATEPQVKRKPKISASRKLQL

Caenorhabditis elegans        KAE------VRKRMEE-----AAKKGSKKKGFLTPERKKKL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 210 Troponin I, cardiac muscle
Region 32 – 79 Involved in binding TNC
Modified residue 23 – 23 Phosphoserine; by PKA and PKD/PRKD1
Modified residue 24 – 24 Phosphoserine; by PKA and PKD/PRKD1
Modified residue 26 – 26 Phosphotyrosine
Modified residue 31 – 31 Phosphothreonine; by STK4/MST1
Modified residue 42 – 42 Phosphoserine; by PKC/PRKCE
Modified residue 44 – 44 Phosphoserine; by PKC/PRKCE
Modified residue 51 – 51 Phosphothreonine; by STK4/MST1


Literature citations

Identification and functional characterization of cardiac troponin I as a novel disease gene in autosomal dominant dilated cardiomyopathy.
Carballo S.; Robinson P.; Otway R.; Fatkin D.; Jongbloed J.D.; de Jonge N.; Blair E.; van Tintelen J.P.; Redwood C.; Watkins H.;
Circ. Res. 105:375-382(2009)
Cited for: VARIANTS CMD1FF GLN-36 AND LYS-185;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.