Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P31327: Variant p.Tyr212Asn

Carbamoyl-phosphate synthase [ammonia], mitochondrial
Gene: CPS1
Feedback?
Variant information Variant position: help 212 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Asparagine (N) at position 212 (Y212N, p.Tyr212Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CPS1D. Any additional useful information about the variant.


Sequence information Variant position: help 212 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1500 The length of the canonical sequence.
Location on the sequence: help FVDPNKQNLIAEVSTKDVKV Y GKGNPTKVVAVDCGIKNNVI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         FVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVI

Mouse                         FVDPNKQNLIAEVSTKDVKVFGKGNPTKVVAVDCGIKNNVI

Rat                           FVDPNKQNLIAEVSTKDVKVFGKGNPTKVVAVDCGIKNNVI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 39 – 1500 Carbamoyl-phosphate synthase [ammonia], mitochondrial
Region 39 – 218 Anthranilate phosphoribosyltransferase homolog
Modified residue 197 – 197 N6-acetyllysine
Modified residue 207 – 207 N6-acetyllysine; alternate
Modified residue 207 – 207 N6-glutaryllysine; alternate
Modified residue 207 – 207 N6-succinyllysine; alternate
Modified residue 210 – 210 N6-acetyllysine; alternate
Modified residue 210 – 210 N6-glutaryllysine; alternate
Modified residue 214 – 214 N6-acetyllysine; alternate
Modified residue 214 – 214 N6-glutaryllysine; alternate
Modified residue 214 – 214 N6-succinyllysine; alternate
Modified residue 219 – 219 N6-acetyllysine; alternate
Modified residue 219 – 219 N6-glutaryllysine; alternate
Modified residue 228 – 228 N6-acetyllysine; alternate
Modified residue 228 – 228 N6-glutaryllysine; alternate
Alternative sequence 1 – 451 Missing. In isoform 2.
Beta strand 210 – 213



Literature citations
Molecular and clinical analyses of Japanese patients with carbamoylphosphate synthetase 1 (CPS1) deficiency.
Kurokawa K.; Yorifuji T.; Kawai M.; Momoi T.; Nagasaka H.; Takayanagi M.; Kobayashi K.; Yoshino M.; Kosho T.; Adachi M.; Otsuka H.; Yamamoto S.; Murata T.; Suenaga A.; Ishii T.; Terada K.; Shimura N.; Kiwaki K.; Shintaku H.; Yamakawa M.; Nakabayashi H.; Wakutani Y.; Nakahata T.;
J. Hum. Genet. 52:349-354(2007)
Cited for: VARIANTS CPS1D GLU-79; ASN-212; ASN-280; PRO-438; HIS-587; ARG-593; LYS-651; ILE-674; HIS-780; CYS-850; ASP-982; ARG-1103; GLY-1141; PRO-1195; VAL-1215 AND LYS-1241;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.