Expasy logo

UniProtKB/Swiss-Prot variant pages

Due to scheduled maintenance work, this service may suffer downtimes today between 07:00 p.m. until 10:00 p.m. CEST.
Apologies for the inconvenience.

UniProtKB/Swiss-Prot P31327: Variant p.Arg850Cys

Carbamoyl-phosphate synthase [ammonia], mitochondrial
Gene: CPS1
Feedback?
Variant information Variant position: help 850 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Cysteine (C) at position 850 (R850C, p.Arg850Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CPS1D; moderate decrease in protein yield and partial loss of enzyme activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 850 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1500 The length of the canonical sequence.
Location on the sequence: help NKEWPSNLDLRKELSEPSST R IYAIAKAIDDNMSLDEIEKL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         NKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKL

Mouse                         NKEWPANLDLKKELSEPSSTRIYAIAKALENNMSLDEIVRL

Rat                           NKEWPANLDLRKELSEPSSTRIYAIAKALENNMSLDEIVKL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 39 – 1500 Carbamoyl-phosphate synthase [ammonia], mitochondrial
Modified residue 831 – 831 N6-acetyllysine; alternate
Modified residue 831 – 831 N6-succinyllysine; alternate
Modified residue 835 – 835 Phosphoserine
Modified residue 841 – 841 N6-acetyllysine; alternate
Modified residue 841 – 841 N6-glutaryllysine; alternate
Modified residue 856 – 856 N6-acetyllysine; alternate
Modified residue 856 – 856 N6-glutaryllysine; alternate
Modified residue 869 – 869 N6-glutaryllysine
Helix 850 – 859



Literature citations
Molecular and clinical analyses of Japanese patients with carbamoylphosphate synthetase 1 (CPS1) deficiency.
Kurokawa K.; Yorifuji T.; Kawai M.; Momoi T.; Nagasaka H.; Takayanagi M.; Kobayashi K.; Yoshino M.; Kosho T.; Adachi M.; Otsuka H.; Yamamoto S.; Murata T.; Suenaga A.; Ishii T.; Terada K.; Shimura N.; Kiwaki K.; Shintaku H.; Yamakawa M.; Nakabayashi H.; Wakutani Y.; Nakahata T.;
J. Hum. Genet. 52:349-354(2007)
Cited for: VARIANTS CPS1D GLU-79; ASN-212; ASN-280; PRO-438; HIS-587; ARG-593; LYS-651; ILE-674; HIS-780; CYS-850; ASP-982; ARG-1103; GLY-1141; PRO-1195; VAL-1215 AND LYS-1241;
Understanding carbamoyl phosphate synthetase (CPS1) deficiency by using the recombinantly purified human enzyme: effects of CPS1 mutations that concentrate in a central domain of unknown function.
Diez-Fernandez C.; Hu L.; Cervera J.; Haeberle J.; Rubio V.;
Mol. Genet. Metab. 112:123-132(2014)
Cited for: VARIANTS CPS1D ARG-401; ARG-632; SER-843; CYS-850; HIS-850; PRO-871; VAL-911; GLU-911; LEU-913; HIS-914; GLY-914; PRO-918; THR-932; ASN-937; THR-949; PRO-958; CYS-959; CYS-962; ASP-964; ASP-1194 AND ARG-1462; VARIANT GLU-875; CHARACTERIZATION OF VARIANTS CPS1D SER-843; CYS-850; HIS-850; PRO-871; VAL-911; GLU-911; LEU-913; HIS-914; GLY-914; PRO-918; THR-932; ASN-937; THR-949; PRO-958; CYS-959; CYS-962 AND ASP-964; CATALYTIC ACTIVITY; CHARACTERIZATION OF VARIANT GLU-875;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.