UniProtKB/SwissProt variant VAR

Variant information

Variant position:

148

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Asparagine (N) to Lysine (K) at position 148 (N148K, p.Asn148Lys).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and polar (N) to large size and basic (K)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

0

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Woolly hair autosomal dominant (ADWH) [MIM:194300]: A hair shaft disorder characterized by fine and tightly curled hair. Compared to normal curly hair that is observed in some populations, woolly hair grows slowly and stops growing after a few inches. Under light microscopy, woolly hair shows some structural anomalies, including trichorrhexis nodosa and tapered ends. {ECO:0000269|PubMed:20346438}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In ADWH; results in disruption of keratin intermediate filament formation in cultured cells.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs267607205 [ dbSNP | Ensembl ]

Sequence information

Variant position:

148

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

529

The length of the canonical sequence.

Location on the sequence:

ELDPEIQKVRAQEREQIKVL N DKFASFIDKVRFLEQQNQVL

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ELDPEIQKVRAQEREQIKVLNDKFASFIDKVRFLEQQNQVL

Mouse                         ELDPEIQKVRAQEREQIKALNDKFASFIDKVRFLEQQNQVL

Bovine                        ELDPEIQKVRAQEREQIMALNNKFASFIDKVRFLEQQNQVL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 529	Keratin, type II cytoskeletal 74
Domain	140 – 453	IF rod
Region	140 – 175	Coil 1A

Literature citations

Autosomal-dominant woolly hair resulting from disruption of keratin 74 (KRT74), a potential determinant of human hair texture.
Shimomura Y.; Wajid M.; Petukhova L.; Kurban M.; Christiano A.M.;
Am. J. Hum. Genet. 86:632-638(2010)
Cited for: VARIANT ADWH LYS-148; CHARACTERIZATION OF VARIANT ADWH LYS-148;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q7RTS7: Variant p.Asn148Lys