Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9UQ90: Variant p.Ala510Val

Mitochondrial inner membrane m-AAA protease component paraplegin
Gene: SPG7
Feedback?
Variant information Variant position: help 510 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Alanine (A) to Valine (V) at position 510 (A510V, p.Ala510Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SPG7; function impaired. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 510 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 795 The length of the canonical sequence.
Location on the sequence: help EQHLKSLKLTQSSTFYSQRL A ELTPGFSGADIANICNEAAL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         EQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAAL

Mouse                         EQHLKGLKLTQPSSFYSQRLAELTPGFSGADIANICNEAAL

Rat                           EQHLKGLKLTQPSSFYSQRLAELTPGFSGADIANICNEAAL

Slime mold                    DS------WTYDNIIYTVYQVNLT------NIGTLSVESVI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 106 – 795 Mitochondrial inner membrane m-AAA protease component paraplegin
Topological domain 270 – 795 Mitochondrial matrix
Modified residue 505 – 505 3'-nitrotyrosine
Alternative sequence 490 – 795 Missing. In isoform 2.
Helix 502 – 511



Literature citations
Mutation analysis of the paraplegin gene (SPG7) in patients with hereditary spastic paraplegia.
Elleuch N.; Depienne C.; Benomar A.; Hernandez A.M.; Ferrer X.; Fontaine B.; Grid D.; Tallaksen C.M.E.; Zemmouri R.; Stevanin G.; Durr A.; Brice A.;
Neurology 66:654-659(2006)
Cited for: VARIANTS SPG7 VAL-510 AND VAL-581 DEL; VARIANTS THR-2; GLN-82 DEL; PRO-284; HIS-294; GLN-486; ALA-503; LEU-545; THR-603; LEU-635; THR-645; HIS-650; GLN-688 AND ASP-730; Functional evaluation of paraplegin mutations by a yeast complementation assay.
Bonn F.; Pantakani K.; Shoukier M.; Langer T.; Mannan A.U.;
Hum. Mutat. 31:617-621(2010)
Cited for: VARIANTS SPG7 SER-349; VAL-510 AND CYS-583; VARIANTS ALA-503 AND GLN-688; CHARACTERIZATION OF VARIANTS SPG7 SER-349; VAL-510 AND CYS-583; CHARACTERIZATION OF VARIANTS ALA-503 AND GLN-688; Genetic and phenotypic characterization of complex hereditary spastic paraplegia.
Kara E.; Tucci A.; Manzoni C.; Lynch D.S.; Elpidorou M.; Bettencourt C.; Chelban V.; Manole A.; Hamed S.A.; Haridy N.A.; Federoff M.; Preza E.; Hughes D.; Pittman A.; Jaunmuktane Z.; Brandner S.; Xiromerisiou G.; Wiethoff S.; Schottlaender L.; Proukakis C.; Morris H.; Warner T.; Bhatia K.P.; Korlipara L.V.; Singleton A.B.; Hardy J.; Wood N.W.; Lewis P.A.; Houlden H.;
Brain 139:1904-1918(2016)
Cited for: VARIANT SPG7 VAL-510;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.