Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O14773: Variant p.Pro544Ser

Tripeptidyl-peptidase 1
Gene: TPP1
Feedback?
Variant information Variant position: help 544 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Serine (S) at position 544 (P544S, p.Pro544Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CLN2; displays residual enzyme activity; effectively transported to the lysosome. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 544 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 563 The length of the canonical sequence.
Location on the sequence: help ESCLDEEVEGQGFCSGPGWD P VTGWGTPNFPALLKTLLNP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         ESCLDEEVEGQGFCSGPGWD------------------------------PVTGWGTPNFPALLKTLLNP-----

                              ESCLNEEVQGQGFCSGPGWD--------------------

Chimpanzee                    ESCLDEEVEGQGFCSGPGWD--------------------

Mouse                         ESCLNEEVEGQGFCSGPGWD--------------------

Rat                           ESCLNEEVEGQGFCSGPGWD--------------------

Bovine                        ESCLNEEVEGQGFCSGPGWD--------------------

Zebrafish                     LSCLDDKVEGKGFCASPSWD--------------------

Slime mold                    KCCTN------GFKSKSGWD--------------------

Baker's yeast                 ----------------------------------------

Fission yeast                 SSYPEDSLPSFIFCAGDDRTDEDMFRSLHKNTRINKETSF
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 196 – 563 Tripeptidyl-peptidase 1
Domain 199 – 563 Peptidase S53
Binding site 539 – 539
Binding site 541 – 541
Binding site 543 – 543
Turn 544 – 546



Literature citations
Functional consequences and rescue potential of pathogenic missense mutations in tripeptidyl peptidase I.
Walus M.; Kida E.; Golabek A.A.;
Hum. Mutat. 31:710-721(2010)
Cited for: VARIANT CLN2 SER-544; CHARACTERIZATION OF VARIANTS CLN2 ARG-77; GLN-127; LEU-202; CYS-206; MET-277; VAL-284; SER-286; ASN-287; LYS-343; ARG-365; HIS-422; HIS-447; LEU-475 AND SER-544;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.