Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q68CP4: Variant p.Pro265Gln

Heparan-alpha-glucosaminide N-acetyltransferase
Gene: HGSNAT
Feedback?
Variant information Variant position: help 265 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Glutamine (Q) at position 265 (P265Q, p.Pro265Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MPS3C; likely benign; does not influence stability; does not influence activity; does not influence cellular localization of the enzyme. Any additional useful information about the variant.


Sequence information Variant position: help 265 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 663 The length of the canonical sequence.
Location on the sequence: help SRTDPLDGDVQPATWRLSAL P PRLRSVDTFRGIALILMVFV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SRTDPLDGDVQPATWRLSALPPRLRSVDTFRGIALILMVFV

Mouse                         SRADPLSADYQPETRRSSA--NRLRCVDTFRGLALVLMVFV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 663 Heparan-alpha-glucosaminide N-acetyltransferase
Topological domain 212 – 275 Cytoplasmic
Modified residue 245 – 245 Phosphoserine
Disulfide bond 151 – 462



Literature citations
Protein misfolding as an underlying molecular defect in mucopolysaccharidosis III type C.
Feldhammer M.; Durand S.; Pshezhetsky A.V.;
PLoS ONE 4:E7434-E7434(2009)
Cited for: FUNCTION; GLYCOSYLATION; CHARACTERIZATION OF VARIANTS MPS3C LEU-509 AND THR-643; CHARACTERIZATION OF VARIANTS PHE-104; PRO-165; GLN-265; ARG-290; LYS-301; LEU-311; HIS-372; CYS-431; SER-452; LYS-499; LYS-510; GLU-517; PHE-546; GLN-551; CYS-567; LEU-569; VAL-590 AND LEU-599; Mutations in TMEM76 cause mucopolysaccharidosis IIIC (Sanfilippo C syndrome).
Hrebicek M.; Mrazova L.; Seyrantepe V.; Durand S.; Roslin N.M.; Noskova L.; Hartmannova H.; Ivanek R.; Cizkova A.; Poupetova H.; Sikora J.; Urinovska J.; Stranecky V.; Zeman J.; Lepage P.; Roquis D.; Verner A.; Ausseil J.; Beesley C.E.; Maire I.; Poorthuis B.J.H.M.; van de Kamp J.; van Diggelen O.P.; Wevers R.A.; Hudson T.J.; Fujiwara T.M.; Majewski J.; Morgan K.; Kmoch S.; Pshezhetsky A.V.;
Am. J. Hum. Genet. 79:807-819(2006)
Cited for: VARIANTS MPS3C PHE-104; GLN-265; LEU-311; CYS-372; HIS-372; CYS-431; SER-452; LYS-499; LYS-510; GLN-551; LEU-569; VAL-590; LEU-599 AND THR-643; FUNCTION; SUBCELLULAR LOCATION; TISSUE SPECIFICITY; Mutational analysis of the HGSNAT gene in Italian patients with mucopolysaccharidosis IIIC (Sanfilippo C syndrome). Mutation in brief #959. Online.
Fedele A.O.; Filocamo M.; Di Rocco M.; Sersale G.; Luebke T.; di Natale P.; Cosma M.P.; Ballabio A.;
Hum. Mutat. 28:523-523(2007)
Cited for: VARIANTS MPS3C PRO-165; GLN-265 AND PHE-546; Clinical and genetic spectrum of Sanfilippo type C (MPS IIIC) disease in The Netherlands.
Ruijter G.J.G.; Valstar M.J.; van de Kamp J.M.; van der Helm R.M.; Durand S.; van Diggelen O.P.; Wevers R.A.; Poorthuis B.J.; Pshezhetsky A.V.; Wijburg F.A.;
Mol. Genet. Metab. 93:104-111(2008)
Cited for: VARIANTS MPS3C PRO-165; GLN-265; ARG-280; LYS-301; CYS-372; LYS-499; PHE-546 AND CYS-567; Sanfilippo syndrome type C: mutation spectrum in the heparan sulfate acetyl-CoA: alpha-glucosaminide N-acetyltransferase (HGSNAT) gene.
Feldhammer M.; Durand S.; Mrazova L.; Boucher R.-M.; Laframboise R.; Steinfeld R.; Wraith J.E.; Michelakakis H.; van Diggelen O.P.; Hrebicek M.; Kmoch S.; Pshezhetsky A.V.;
Hum. Mutat. 30:918-925(2009)
Cited for: VARIANTS MPS3C PRO-165; GLN-265; LEU-311; CYS-372; CYS-431; LYS-499; LEU-509; GLU-514; GLU-517; PHE-546; GLN-551; LEU-569 AND THR-643; CHARACTERIZATION OF VARIANTS MPS3C GLN-265; CYS-431; LEU-509; GLN-551 AND THR-643; Functional analysis of the HGSNAT gene in patients with mucopolysaccharidosis IIIC (Sanfilippo C Syndrome).
Fedele A.O.; Hopwood J.J.;
Hum. Mutat. 31:E1574-E1586(2010)
Cited for: CHARACTERIZATION OF VARIANTS MPS3C PHE-104; PRO-165; GLN-265; ARG-290; LEU-311; CYS-372; CYS-431; SER-452; LYS-499; LEU-509; LYS-510; GLU-514; GLU-517; PHE-546; GLN-551; CYS-567; LEU-569; VAL-590; LEU-599 AND THR-643; Molecular analysis of Sanfilippo syndrome type C in Spain: seven novel HGSNAT mutations and characterization of the mutant alleles.
Canals I.; Elalaoui S.C.; Pineda M.; Delgadillo V.; Szlago M.; Jaouad I.C.; Sefiani A.; Chabas A.; Coll M.J.; Grinberg D.; Vilageliu L.;
Clin. Genet. 80:367-374(2011)
Cited for: VARIANTS MPS3C VAL-82; PRO-141; VAL-452 AND PRO-473; VARIANT GLN-265; CHARACTERIZATION OF VARIANTS MPS3C VAL-82; PRO-141; CYS-372; VAL-452; PRO-473 AND PHE-546; CHARACTERIZATION OF VARIANT GLN-265;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.