Home  |  Contact

UniProtKB/Swiss-Prot Q8IXK2: Variant p.Arg552Lys

Polypeptide N-acetylgalactosaminyltransferase 12
Gene: GALNT12
Variant information

Variant position:  552
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Lysine (K) at position 552 (R552K, p.Arg552Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are large size and basic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  552
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  581
The length of the canonical sequence.

Location on the sequence:   ILQEDGSLFHEQSKKCVQAA  R KESSDSFVPLLRDCTNSDHQ
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSD-HQ

Mouse                         ILQEDGTLVHKHSRKCVEATEKVLDNGFAPYLRDCTNSD-N

Drosophila                    HYDSVSNQLMSNT-KCLE-----FTDELNIFLAICDAANGK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 581 Polypeptide N-acetylgalactosaminyltransferase 12
Topological domain 38 – 581 Lumenal
Domain 445 – 577 Ricin B-type lectin
Disulfide bond 547 – 566


Literature citations

Inactivating germ-line and somatic mutations in polypeptide N-acetylgalactosaminyltransferase 12 in human colon cancers.
Guda K.; Moinova H.; He J.; Jamison O.; Ravi L.; Natale L.; Lutterbaugh J.; Lawrence E.; Lewis S.; Willson J.K.; Lowe J.B.; Wiesner G.L.; Parmigiani G.; Barnholtz-Sloan J.; Dawson D.W.; Velculescu V.E.; Kinzler K.W.; Papadopoulos N.; Vogelstein B.; Willis J.; Gerken T.A.; Markowitz S.D.;
Proc. Natl. Acad. Sci. U.S.A. 106:12921-12925(2009)
Cited for: VARIANTS CRCS1 TRP-297; ASN-303; ASP-341; HIS-373; HIS-382; PHE-479 AND MET-491; CHARACTERIZATION OF VARIANTS CRCS1 TRP-297; ASN-303; ASP-341; HIS-373; HIS-382; PHE-479 AND MET-491; VARIANTS GLU-3; ARG-46; VAL-119; ASN-261; ARG-272 AND LYS-552;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.