Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02462: Variant p.Gly1580Arg

Collagen alpha-1(IV) chain
Gene: COL4A1
Feedback?
Variant information Variant position: help 1580 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Arginine (R) at position 1580 (G1580R, p.Gly1580Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BSVD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1580 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1669 The length of the canonical sequence.
Location on the sequence: help VHSQTIQIPPCPSGWSSLWI G YSFVMHTSAGAEGSGQALAS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALAS

Mouse                         VHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALAS

Bovine                        VHSQTIQIPQCPTGWSSLWIGYSFVMHTSAGAEGSGQALAS

Caenorhabditis elegans        VHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQS

Drosophila                    VHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 173 – 1669 Collagen alpha-1(IV) chain
Chain 1445 – 1669 Arresten
Domain 1445 – 1669 Collagen IV NC1
Disulfide bond 1570 – 1665
Alternative sequence 520 – 1669 Missing. In isoform 2.
Beta strand 1574 – 1587



Literature citations
COL4A1 mutation in two preterm siblings with antenatal onset of parenchymal hemorrhage.
de Vries L.S.; Koopman C.; Groenendaal F.; Van Schooneveld M.; Verheijen F.W.; Verbeek E.; Witkamp T.D.; van der Worp H.B.; Mancini G.;
Ann. Neurol. 65:12-18(2009)
Cited for: VARIANT BSVD1 ARG-1580;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.