Home  |  Contact

UniProtKB/Swiss-Prot Q8NBS3: Variant p.Gly418Asp

Sodium bicarbonate transporter-like protein 11
Gene: SLC4A11
Variant information

Variant position:  418
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glycine (G) to Aspartate (D) at position 418 (G418D, p.Gly418Asp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to medium size and acidic (D)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In CHED.
Any additional useful information about the variant.



Sequence information

Variant position:  418
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  891
The length of the canonical sequence.

Location on the sequence:   DENTDGAIDVQKTIAGQSIG  G LLYALFSGQPLVILLTTAPL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPL

Mouse                         DENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 891 Sodium bicarbonate transporter-like protein 11
Transmembrane 416 – 436 Helical
Region 376 – 891 Membrane (bicarbonate transporter)
Alternative sequence 1 – 482 Missing. In isoform 2.


Literature citations

Mutational spectrum of the SLC4A11 gene in autosomal recessive congenital hereditary endothelial dystrophy.
Sultana A.; Garg P.; Ramamurthy B.; Vemuganti G.K.; Kannabiran C.;
Mol. Vis. 13:1327-1332(2007)
Cited for: VARIANTS CHED TRP-209; LEU-213; CYS-233; LYS-401; ASP-418; ARG-473; LEU-489; LYS-584; TRP-755; GLN-755; LEU-773; MET-824 AND CYS-869;

Mutational spectrum of SLC4A11 in autosomal recessive CHED in Saudi Arabia.
Aldahmesh M.A.; Khan A.O.; Meyer B.F.; Alkuraya F.S.;
Invest. Ophthalmol. Vis. Sci. 50:4142-4145(2009)
Cited for: VARIANTS CHED ARG-394 AND ASP-418;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.