UniProtKB/SwissProt variant VAR

Variant information

Variant position:

367

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Arginine (R) to Histidine (H) at position 367 (R367H, p.Arg367His).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

0

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A3 (MDDGA3) [MIM:253280]: An autosomal recessive disorder characterized by congenital muscular dystrophy, ocular abnormalities, cobblestone lissencephaly, and cerebellar and pontine hypoplasia. Patients present severe congenital myopia, congenital glaucoma, pallor of the optic disks, retinal hypoplasia, mental retardation, hydrocephalus, abnormal electroencephalograms, generalized muscle weakness and myoclonic jerks. Included diseases are the more severe Walker-Warburg syndrome and the slightly less severe muscle-eye-brain disease. {ECO:0000269|PubMed:11709191, ECO:0000269|PubMed:12588800, ECO:0000269|PubMed:12788071, ECO:0000269|PubMed:15207699, ECO:0000269|PubMed:15236414, ECO:0000269|PubMed:15466003, ECO:0000269|PubMed:17030669, ECO:0000269|PubMed:19067344}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In MDDGA3.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs762972459 [ dbSNP | Ensembl ]

Sequence information

Variant position:

367

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

660

The length of the canonical sequence.

Location on the sequence:

VVALFGLRGIQHTPISIKNA R VSQHYKASLTATFNLFPEAK

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VVALFGLRGIQHTPISIKNARVSQHYKASLTATFNLFPEAK

Mouse                         VVALFGLRGIQHTPISIKNARVSQHYKASLTATFNLFPEAK

Rat                           VVALFGLRGIQHTPISIKNARVSQHYKASLTATFNLFPEAK

Bovine                        VVALFGLRGIQHTPISIKNARVSQHYKASLTATFNLFPEAK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 660	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
Topological domain	59 – 660	Lumenal
Region	300 – 646	Catalytic
Binding site	371 – 371	UDP-GlcNAc
Helix	364 – 382

Literature citations

Brain involvement in muscular dystrophies with defective dystroglycan glycosylation.
Clement E.; Mercuri E.; Godfrey C.; Smith J.; Robb S.; Kinali M.; Straub V.; Bushby K.; Manzur A.; Talim B.; Cowan F.; Quinlivan R.; Klein A.; Longman C.; McWilliam R.; Topaloglu H.; Mein R.; Abbs S.; North K.; Barkovich A.J.; Rutherford M.; Muntoni F.;
Ann. Neurol. 64:573-582(2008)
Cited for: VARIANTS MDDGA3 PRO-176; HIS-367 AND HIS-427; VARIANT MDDGB3 TYR-490;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8WZA1: Variant p.Arg367His