UniProtKB/SwissProt variant VAR

Variant information

Variant position:

493

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Glycine (G) to Arginine (R) at position 493 (G493R, p.Gly493Arg).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from glycine (G) to large size and basic (R)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Posterior column ataxia with retinitis pigmentosa (PCARP) [MIM:609033]: A neurodegenerative syndrome beginning in infancy with areflexia and retinitis pigmentosa. Nyctalopia (night blindness) and peripheral visual field loss are usually evident during late childhood or teenage years, with subsequent progressive constriction of the visual fields and loss of central retinal function over time. A sensory ataxia caused by degeneration of the posterior columns of the spinal cord results in a loss of proprioceptive sensation that is clinically evident in the second decade of life and gradually progresses. Scoliosis, camptodactyly, achalasia, gastrointestinal dysmotility, and a sensory peripheral neuropathy are variable features of the disease. Affected individuals have no clinical or radiological evidence of cerebral or cerebellar involvement. {ECO:0000269|PubMed:21070897, ECO:0000269|PubMed:21267618}. Note=The disease is caused by mutations affecting the gene represented in this entry. Defective neuronal heme transmembrane export due to FLVCR1 mutations may abrogate the neuroprotective effects of neuroglobin and initiate an apoptotic cascade that results in the selective degeneration of photoreceptors in the neurosensory retina and sensory neurons in the posterior spinal cord.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In PCARP.

Any additional useful information about the variant.

Sequence information

Variant position:

493

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

555

The length of the canonical sequence.

Location on the sequence:

FGILFTLAQGKLTSDYGPKA G NIFLCVWMFIGIILTALIKS

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FGILFTLAQGKLTSDYG-PKAGNIFLCVWMFIGIILTALIKS

Mouse                         LGIFFTLAQGKITTDYNSPEAGNIFLCAWMFVGIILTALIK

Cat                           FGILFTLAQGKLTTDYS-PKAGNIFLCVWLFLGIILTALIK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 555	Feline leukemia virus subgroup C receptor-related protein 1
Transmembrane	491 – 511	Helical

Literature citations

Posterior column ataxia with retinitis pigmentosa in a Japanese family with a novel mutation in FLVCR1.
Ishiura H.; Fukuda Y.; Mitsui J.; Nakahara Y.; Ahsan B.; Takahashi Y.; Ichikawa Y.; Goto J.; Sakai T.; Tsuji S.;
Neurogenetics 12:117-121(2011)
Cited for: VARIANT PCARP ARG-493;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y5Y0: Variant p.Gly493Arg