Home  |  Contact

UniProtKB/Swiss-Prot Q6PGP7: Variant p.Ala1077Asp

Tetratricopeptide repeat protein 37
Gene: TTC37
Variant information

Variant position:  1077
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Aspartate (D) at position 1077 (A1077D, p.Ala1077Asp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and acidic (D)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Trichohepatoenteric syndrome 1 (THES1) [MIM:222470]: A syndrome characterized by intrauterine growth retardation, severe diarrhea in infancy requiring total parenteral nutrition, facial dysmorphism, immunodeficiency, and hair abnormalities, mostly trichorrhexis nodosa. Hepatic involvement contributes to the poor prognosis of affected patients. {ECO:0000269|PubMed:20176027}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  Found in a THES1 patient.
Any additional useful information about the variant.



Sequence information

Variant position:  1077
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1564
The length of the canonical sequence.

Location on the sequence:   FALALFMKGLYKESSKAYER  A LSIVESEQDKAHILTALAIT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FALALFMKGLYKESSKAYERALSIVESEQDKAHILTALAIT

Xenopus laevis                IALAFFKKGLLQESMKAYKQALSVAKSDQEKAHILTALAII

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 1564 Tetratricopeptide repeat protein 37
Repeat 1056 – 1084 TPR 18


Literature citations

Novel mutations in TTC37 associated with Tricho-Hepato-Enteric syndrome.
Fabre A.; Martinez-Vinson C.; Roquelaure B.; Missirian C.; Andre N.; Breton A.; Lachaux A.; Odul E.; Colomb V.; Lemale J.; Cezard J.P.; Goulet O.; Sarles J.; Levy N.; Badens C.;
Hum. Mutat. 32:277-281(2011)
Cited for: TISSUE SPECIFICITY; VARIANTS 860-ASN--GLU-878 DEL; ASP-1077; ALA-1270 AND ARG-1485; ASSOCIATION WITH THES1;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.