Home  |  Contact

UniProtKB/Swiss-Prot P07738: Variant p.Arg90Cys

Bisphosphoglycerate mutase
Gene: BPGM
Variant information

Variant position:  90
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Cysteine (C) at position 90 (R90C, p.Arg90Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Erythrocytosis, familial, 8 (ECYT8) [MIM:222800]: An autosomal recessive disorder characterized by elevated serum hemoglobin and hematocrit, and biphosphoglycerate mutase deficiency. ECYT8 affected individuals manifest hemolytic anemia and splenomegaly. {ECO:0000269|PubMed:1421379, ECO:0000269|PubMed:15054810, ECO:0000269|PubMed:2542247}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In ECYT8; mutation identified at protein level; marked decrease in synthase and mutase activities; no effect on phosphatase activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  90
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  259
The length of the canonical sequence.

Location on the sequence:   ILEELGQEWVPVESSWRLNE  R HYGALIGLNREQMALNHGEE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEE

Mouse                         ILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEE

Bovine                        ILEELGQEWVPVESSWRLNERHYGALISLNREQMALNHGEE

Rabbit                        ILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 259 Bisphosphoglycerate mutase
Region 89 – 92 Substrate binding
Active site 89 – 89 Proton donor/acceptor
Binding site 100 – 100 Substrate


Literature citations

Isolation, characterization, and structure of a mutant 89 ArgTO: bisphosphoglycerate mutase. Implication of the active site in the mutation.
Rosa R.; Blouquit Y.; Calvin M.C.; Prome D.; Prome J.C.; Rosa J.;
J. Biol. Chem. 264:7837-7843(1989)
Cited for: PARTIAL PROTEIN SEQUENCE; IDENTIFICATION BY MASS SPECTROMETRY; IDENTIFICATION OF VARIANT ECYT8 CYS-90; CHARACTERIZATION OF VARIANT ECYT8 CYS-90; INVOLVEMENT IN ECYT8;

Compound heterozygosity in a complete erythrocyte bisphosphoglycerate mutase deficiency.
Lemarchandel V.; Joulin V.; Valentin C.; Rosa R.; Galacteros F.; Rosa J.; Cohen-Solal M.;
Blood 80:2643-2649(1992)
Cited for: VARIANT ECYT8 CYS-90;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.