Home  |  Contact

UniProtKB/Swiss-Prot P20839: Variant p.Thr116Met

Inosine-5'-monophosphate dehydrogenase 1
Gene: IMPDH1
Chromosomal location: 7q31.3-q32
Variant information

Variant position:  116
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Threonine (T) to Methionine (M) at position 116 (T116M, p.Thr116Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (M)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Retinitis pigmentosa 10 (RP10) [MIM:180105]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. {ECO:0000269|PubMed:11875049, ECO:0000269|PubMed:11875050, ECO:0000269|PubMed:16384941}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In RP10; does not alter the enzymatic affinity of the corresponding enzyme; alters the affinity and/or the specificity of single-stranded nucleic acid.
Any additional useful information about the variant.



Sequence information

Variant position:  116
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  514
The length of the canonical sequence.

Location on the sequence:   TPEFQANEVRKVKKFEQGFI  T DPVVLSPSHTVGDVLEAKMR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMR

Mouse                         TPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQ

Rat                           TPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQ

Bovine                        TPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIR

Xenopus tropicalis            TPEFQANEVR--KKFEQGFITDPVVMSLNHTVGDVFEAKNR

Zebrafish                     TPEFQANEVRKVKKFEQGFITDPVVMSPRHTVGDVFEAKVR

Baker's yeast                 TPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKEK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 514 Inosine-5'-monophosphate dehydrogenase 1
Domain 114 – 173 CBS 1


Literature citations

Spectrum and frequency of mutations in IMPDH1 associated with autosomal dominant retinitis pigmentosa and Leber congenital amaurosis.
Bowne S.J.; Sullivan L.S.; Mortimer S.E.; Hedstrom L.; Zhu J.; Spellicy C.J.; Gire A.I.; Hughbanks-Wheaton D.; Birch D.G.; Lewis R.A.; Heckenlively J.R.; Daiger S.P.;
Invest. Ophthalmol. Vis. Sci. 47:34-42(2006)
Cited for: VARIANTS RP10 MET-116; ASN-226; ILE-268 AND PRO-372; VARIANTS LCA11 TRP-105 AND LYS-198; VARIANTS THR-285 AND ASP-324; CHARACTERIZATION OF VARIANTS RP10 MET-116 AND PRO-372; CHARACTERIZATION OF VARIANTS LCA11 TRP-105 AND LYS-198; CHARACTERIZATION OF VARIANT ASP-324;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.