Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P42224: Variant p.Lys201Asn

Signal transducer and activator of transcription 1-alpha/beta
Gene: STAT1
Feedback?
Variant information Variant position: help 201 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Lysine (K) to Asparagine (N) at position 201 (K201N, p.Lys201Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (K) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In IMD31B; not deleterious in terms of most STAT1 functions; causes abnormal splicing out of exon 8 from most mRNAs thereby decreasing protein levels by approximately 70%. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 201 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 750 The length of the canonical sequence.
Location on the sequence: help EHETNGVAKSDQKQEQLLLK K MYLMLDNKRKEVVHKIIELL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELL

Mouse                         EGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELL

Pig                           EHDTNGVAKNDQKQEQMLLQKMYLMLDNKRKEVVHKIIELL

Caenorhabditis elegans        ----------------------YEHLTQKRNDIVIKLNDGT

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 750 Signal transducer and activator of transcription 1-alpha/beta
Coiled coil 136 – 317
Helix 192 – 229



Literature citations
A novel form of human STAT1 deficiency impairing early but not late responses to interferons.
Kong X.F.; Ciancanelli M.; Al-Hajjar S.; Alsina L.; Zumwalt T.; Bustamante J.; Feinberg J.; Audry M.; Prando C.; Bryant V.; Kreins A.; Bogunovic D.; Halwani R.; Zhang X.X.; Abel L.; Chaussabel D.; Al-Muhsen S.; Casanova J.L.; Boisson-Dupuis S.;
Blood 116:5895-5906(2010)
Cited for: VARIANT IMD31B ASN-201; CHARACTERIZATION OF VARIANT IMD31B ASN-201;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.