Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot O43379: Variant p.Arg438His

WD repeat-containing protein 62
Gene: WDR62
Chromosomal location: 19q13.12
Variant information

Variant position:  438
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Histidine (H) at position 438 (R438H, p.Arg438His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Microcephaly 2, primary, autosomal recessive, with or without cortical malformations (MCPH2) [MIM:604317]: A disease characterized by microcephaly, moderate to severe mental retardation, and various type of cortical malformations in most patients. Microcephaly is defined as a head circumference more than 3 standard deviations below the age-related mean. Cortical malformations include pachygyria with cortical thickening, microgyria, lissencephaly, hypoplasia of the corpus callosum, schizencephaly. All affected individuals have delayed psychomotor development. Some patients have seizures. {ECO:0000269|PubMed:20729831, ECO:0000269|PubMed:20890278, ECO:0000269|PubMed:20890279, ECO:0000269|PubMed:21496009}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MCPH2; the mutant protein does not localize to the spindle pole during mitosis.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  438
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1518
The length of the canonical sequence.

Location on the sequence:   DQRACLPSGSFLTCSSDNTI  R FWNLDSSPDSHWQKNIFSNT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DQRACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNT

Mouse                         DQRACLPSGTFLTCSSDNTIRFWNLDSASDTRWQKNIFSDS

Pig                           DQRACLPSGSFLTCSSDNTIRFWNLDSNPDSHWQKNIFSDT

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 1518 WD repeat-containing protein 62
Repeat 402 – 450 WD 6
Alternative sequence 415 – 1518 Missing. In isoform 3.


Literature citations

WDR62 is associated with the spindle pole and is mutated in human microcephaly.
Nicholas A.K.; Khurshid M.; Desir J.; Carvalho O.P.; Cox J.J.; Thornton G.; Kausar R.; Ansar M.; Ahmad W.; Verloes A.; Passemard S.; Misson J.P.; Lindsay S.; Gergely F.; Dobyns W.B.; Roberts E.; Abramowicz M.; Woods C.G.;
Nat. Genet. 42:1010-1014(2010)
Cited for: TISSUE SPECIFICITY; SUBCELLULAR LOCATION; VARIANTS MCPH2 MET-65; HIS-438 AND ASN-511; VARIANT MCPH2 THR-1078 (ISOFORM 4); CHARACTERIZATION OF VARIANT MCPH2 HIS-438;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.