Sequence information
Variant position: 89 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 325 The length of the canonical sequence.
Location on the sequence:
LGDNFYFTGVQDINDKRFQE
T FEDVFSDRSLRKVPWYVLAG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human LGDNFY--------FTG------------VQDINDKRFQET F---EDVFS----DRSLRKVPWYVLAG
Mouse LGDNFY--------FTG------------VHDASDKRFQET
Rat LGDNFY--------FTG------------VHDANDKRFQET
Pig LGDNFY--------FTG------------VHDAKDKRFQET
Rabbit LGDNFY--------FSG------------VQSVSDKRFQET
Baker's yeast IKSTWYKLSNYTRQFNGSLSFLNDDYEFFIRDDDDLEMETT
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
22 – 325
Tartrate-resistant acid phosphatase type 5
Metal binding
71 – 71
Iron 1
Metal binding
71 – 71
Iron 2
Metal binding
74 – 74
Iron 1
Helix
85 – 89
Literature citations
Tartrate-resistant acid phosphatase deficiency causes a bone dysplasia with autoimmunity and a type I interferon expression signature.
Briggs T.A.; Rice G.I.; Daly S.; Urquhart J.; Gornall H.; Bader-Meunier B.; Baskar K.; Baskar S.; Baudouin V.; Beresford M.W.; Black G.C.; Dearman R.J.; de Zegher F.; Foster E.S.; Frances C.; Hayman A.R.; Hilton E.; Job-Deslandre C.; Kulkarni M.L.; Le Merrer M.; Linglart A.; Lovell S.C.; Maurer K.; Musset L.; Navarro V.; Picard C.; Puel A.; Rieux-Laucat F.; Roifman C.M.; Scholl-Burgi S.; Smith N.; Szynkiewicz M.; Wiedeman A.; Wouters C.; Zeef L.A.; Casanova J.L.; Elkon K.B.; Janckila A.; Lebon P.; Crow Y.J.;
Nat. Genet. 43:127-131(2011)
Cited for: VARIANTS SPENCDI ILE-89; ARG-215; ASN-241 AND LYS-264;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.