Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35555: Variant p.Cys1350Phe

Fibrillin-1
Gene: FBN1
Feedback?
Variant information Variant position: help 1350 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Phenylalanine (F) at position 1350 (C1350F, p.Cys1350Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MFS. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1350 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2871 The length of the canonical sequence.
Location on the sequence: help AHNCGKHAVCTNTAGSFKCS C SPGWIGDGIKCTDLDECSNG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNG

Mouse                         AHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNG

Pig                           AHNCDRHAVCTNTAGSFNCSCSPGWIGDGIKCTDLDECSNG

Bovine                        AHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNG

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 45 – 2731 Fibrillin-1
Domain 1322 – 1362 EGF-like 22; calcium-binding
Glycosylation 1345 – 1345 O-linked (Glc) serine
Glycosylation 1369 – 1369 N-linked (GlcNAc...) asparagine
Disulfide bond 1350 – 1361



Literature citations
Applying massive parallel sequencing to molecular diagnosis of Marfan and Loeys-Dietz syndromes.
Baetens M.; Van Laer L.; De Leeneer K.; Hellemans J.; De Schrijver J.; Van De Voorde H.; Renard M.; Dietz H.; Lacro R.V.; Menten B.; Van Criekinge W.; De Backer J.; De Paepe A.; Loeys B.; Coucke P.J.;
Hum. Mutat. 32:1053-1062(2011)
Cited for: VARIANTS MFS GLY-80; TYR-490; TYR-499; ARG-611; GLY-617; TRP-685; TYR-685; TYR-790; TYR-811; SER-853; TYR-926; SER-1090; ASP-1185; TYR-1284; PHE-1350; ALA-1401; TRP-1431; TYR-1431; ALA-1487; LYS-1489; CYS-1838; TYR-1900; THR-1909; SER-1934; GLY-1976; ARG-1984; ASN-2166; THR-2185; GLY-2247; ARG-2318; TYR-2406; SER-2442; ARG-2511; VAL-2606 DEL; LYS-2610 AND ARG-2646; VARIANTS GLY-1481 AND HIS-2793;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.