Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P00738: Variant p.Ile247Thr

Haptoglobin
Gene: HP
Feedback?
Variant information Variant position: help 247 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Isoleucine (I) to Threonine (T) at position 247 (I247T, p.Ile247Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In AHP; causes reduced expression of the protein. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 247 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 406 The length of the canonical sequence.
Location on the sequence: help KKQLVEIEKVVLHPNYSQVD I GLIKLKQKVSVNERVMPICL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICL

                              KNQLVEVEKVVLHPDYSKVDIGLIKLKQKVPIDERVMPICL

Mouse                         KNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICL

Rat                           KNQLVEIEKVVLHPERSVVDIGLIKLKQKVLVTEKVMPICL

Pig                           KKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICL

Bovine                        KNQLVEVEKVVLHPDHSKVDIGLIKLRQKVPVNDKVMPICL

Rabbit                        RRQLVEIEKVVLHPNYSEVDIGLIKLKDKVPVNERVMPICL
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 19 – 406 Haptoglobin
Chain 162 – 406 Haptoglobin beta chain
Domain 162 – 404 Peptidase S1
Glycosylation 241 – 241 N-linked (GlcNAc...) (complex) asparagine
Disulfide bond 149 – 266 Interchain (between alpha and beta chains)



Literature citations
A novel I247T missense mutation in the haptoglobin 2 beta-chain decreases the expression of the protein and is associated with ahaptoglobinemia.
Teye K.; Quaye I.K.; Koda Y.; Soejima M.; Pang H.; Tsuneoka M.; Amoah A.G.; Adjei A.; Kimura H.;
Hum. Genet. 114:499-502(2004)
Cited for: VARIANT AHP THR-247; CHARACTERIZATION OF VARIANT AHP THR-247;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.