Home  |  Contact

UniProtKB/Swiss-Prot Q86YC2: Variant p.Ala1025Thr

Partner and localizer of BRCA2
Gene: PALB2
Variant information

Variant position:  1025
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Threonine (T) at position 1025 (A1025T, p.Ala1025Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1025
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1186
The length of the canonical sequence.

Location on the sequence:   FLMPPEETILTFAEVQGMQE  A LLGTTIMNNIVIWNLKTGQL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQL

Mouse                         LLMPPDETVLTFAEVQGTQEALLGTTTVNSIVIWNLKTGQL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1186 Partner and localizer of BRCA2
Repeat 1010 – 1052 WD 4
Region 775 – 1186 Required for interaction with POLH and POLH DNA synthesis stimulation
Region 853 – 1186 Interaction with RAD51, BRCA2 and POLH
Mutagenesis 1030 – 1030 T -> I. Unstable and promotes protein degradation; reduces interaction with RAD51C and RAD51.
Beta strand 1025 – 1030


Literature citations

Germline mutations in the PALB2 gene are population specific and occur with low frequencies in familial breast cancer.
Hellebrand H.; Sutter C.; Honisch E.; Gross E.; Wappenschmidt B.; Schem C.; Deissler H.; Ditsch N.; Gress V.; Kiechle M.; Bartram C.R.; Schmutzler R.K.; Niederacher D.; Arnold N.; Meindl A.;
Hum. Mutat. 32:E2176-E2188(2011)
Cited for: VARIANTS TYR-46; GLY-219; CYS-334; SER-337; GLN-414; MET-425; THR-491; ARG-515; ARG-559; GLN-672; VAL-712; LEU-728; SER-864; ALA-917; MET-932; TRP-939; VAL-966; GLU-998; THR-1025; ALA-1043; GLY-1075; ALA-1105; HIS-1114; PRO-1143 AND TYR-1170;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.