Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O14802: Variant p.Met852Val

DNA-directed RNA polymerase III subunit RPC1
Gene: POLR3A
Feedback?
Variant information Variant position: help 852 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Methionine (M) to Valine (V) at position 852 (M852V, p.Met852Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HLD7. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 852 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1390 The length of the canonical sequence.
Location on the sequence: help GFVANSFYSGLTPTEFFFHT M AGREGLVDTAVKTAETGYMQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         GFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQ

Bovine                        GFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQ

Chicken                       GFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQ

Slime mold                    GFVSNSFYTGMIPTEFFFHTMGGREGLVDTAVKTAETGYMQ

Baker's yeast                 GFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMS

Fission yeast                 GFVSNSFYSGLTPTEFLFHAISGREGLVDTAVKTAETGYMS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1390 DNA-directed RNA polymerase III subunit RPC1
Region 843 – 884 Bridging helix
Helix 844 – 879



Literature citations
Mutations of POLR3A encoding a catalytic subunit of RNA polymerase Pol III cause a recessive hypomyelinating leukodystrophy.
Bernard G.; Chouery E.; Putorti M.L.; Tetreault M.; Takanohashi A.; Carosso G.; Clement I.; Boespflug-Tanguy O.; Rodriguez D.; Delague V.; Abou Ghoch J.; Jalkh N.; Dorboz I.; Fribourg S.; Teichmann M.; Megarbane A.; Schiffmann R.; Vanderver A.; Brais B.;
Am. J. Hum. Genet. 89:415-423(2011)
Cited for: VARIANTS HLD7 ASN-372; LEU-558; TYR-636; GLU-672; TYR-724; ILE-775; VAL-852 AND THR-1247 INS; INVOLVEMENT IN HLD7; TISSUE SPECIFICITY; Mutations in POLR3A and POLR3B are a major cause of hypomyelinating leukodystrophies with or without dental abnormalities and/or hypogonadotropic hypogonadism.
Daoud H.; Tetreault M.; Gibson W.; Guerrero K.; Cohen A.; Gburek-Augustat J.; Synofzik M.; Brais B.; Stevens C.A.; Sanchez-Carpintero R.; Goizet C.; Naidu S.; Vanderver A.; Bernard G.;
J. Med. Genet. 50:194-197(2013)
Cited for: VARIANTS HLD7 LEU-91; GLY-387; ARG-602; VAL-852; CYS-1005 AND LYS-1261;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.