Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NSK7: Variant p.Gly58Arg

Protein C19orf12
Gene: C19orf12
Feedback?
Variant information Variant position: help 58 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Arginine (R) at position 58 (G58R, p.Gly58Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In NBIA4; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 58 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 141 The length of the canonical sequence.
Location on the sequence: help MAFVGGLVGGPPGLAVGGAV G GLLGAWMTSGQFKPVPQILM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         MAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILM

Mouse                         MAFVGGLVGGPPGIAVGGTVGGLLGAWMTSGQFKPVPQILM

Bovine                        VAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQIIM

Xenopus tropicalis            GAFLGGLVGGPPGIAVGGAVGGAMGAWMTSGQFKPIPQIIM

Zebrafish                     LAFAGGLIGGPLGIAVGGAVGGLLGCWMKSGQFKPLPQVIM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 141 Protein C19orf12
Transmembrane 40 – 60 Helical
Alternative sequence 1 – 64 Missing. In isoform 2.



Literature citations
Absence of an orphan mitochondrial protein, c19orf12, causes a distinct clinical subtype of neurodegeneration with brain iron accumulation.
Hartig M.B.; Iuso A.; Haack T.; Kmiec T.; Jurkiewicz E.; Heim K.; Roeber S.; Tarabin V.; Dusi S.; Krajewska-Walasek M.; Jozwiak S.; Hempel M.; Winkelmann J.; Elstner M.; Oexle K.; Klopstock T.; Mueller-Felber W.; Gasser T.; Trenkwalder C.; Tiranti V.; Kretzschmar H.; Schmitz G.; Strom T.M.; Meitinger T.; Prokisch H.;
Am. J. Hum. Genet. 89:543-550(2011)
Cited for: VARIANTS NBIA4 ARG-42; GLU-54 AND ARG-58; VARIANT NBIA4 MET-11 (ISOFORM 4); VARIANTS GLU-131 AND THR-131; SUBCELLULAR LOCATION; INDUCTION; New NBIA subtype: genetic, clinical, pathologic, and radiographic features of MPAN.
Hogarth P.; Gregory A.; Kruer M.C.; Sanford L.; Wagoner W.; Natowicz M.R.; Egel R.T.; Subramony S.H.; Goldman J.G.; Berry-Kravis E.; Foulds N.C.; Hammans S.R.; Desguerre I.; Rodriguez D.; Wilson C.; Diedrich A.; Green S.; Tran H.; Reese L.; Woltjer R.L.; Hayflick S.J.;
Neurology 80:268-275(2013)
Cited for: VARIANTS NBIA4 PHE-28; PRO-37; ARG-42; LEU-49; GLU-54; VAL-54; ARG-58; LEU-72; SER-87 AND PRO-123; VARIANTS GLU-131; THR-131 AND ARG-138; Hereditary spastic paraplegia type 43 (SPG43) is caused by mutation in C19orf12.
Landoure G.; Zhu P.P.; Lourenco C.M.; Johnson J.O.; Toro C.; Bricceno K.V.; Rinaldi C.; Meilleur K.G.; Sangare M.; Diallo O.; Pierson T.M.; Ishiura H.; Tsuji S.; Hein N.; Fink J.K.; Stoll M.; Nicholson G.; Gonzalez M.A.; Speziani F.; Durr A.; Stevanin G.; Biesecker L.G.; Accardi J.; Landis D.M.; Gahl W.A.; Traynor B.J.; Marques W. Jr.; Zuchner S.; Blackstone C.; Fischbeck K.H.; Burnett B.G.;
Hum. Mutat. 34:1357-1360(2013)
Cited for: VARIANT SPG43 PRO-52; VARIANTS NBIA4 PRO-52 AND GLY-55 DEL; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS SPG43 PRO-52; CHARACTERIZATION OF VARIANTS NBIA4 PRO-52; GLY-55 DEL AND ARG-58; Analysis of the C19orf12 and WDR45 genes in patients with neurodegeneration with brain iron accumulation.
Tschentscher A.; Dekomien G.; Ross S.; Cremer K.; Kukuk G.M.; Epplen J.T.; Hoffjan S.;
J. Neurol. Sci. 349:105-109(2015)
Cited for: VARIANT NBIA4 ARG-58; VARIANT NBIA4 MET-11 (ISOFORM 4);
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.