Home  |  Contact

UniProtKB/Swiss-Prot P41227: Variant p.Ser37Pro

N-alpha-acetyltransferase 10
Gene: NAA10
Variant information

Variant position:  37
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Serine (S) to Proline (P) at position 37 (S37P, p.Ser37Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and polar (S) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  N-terminal acetyltransferase deficiency (NATD) [MIM:300855]: An enzymatic deficiency resulting in postnatal growth failure with severe delays and dysmorphic features. It is clinically characterized by wrinkled forehead, prominent eyes, widely opened anterior and posterior fontanels, downsloping palpebral fissures, thickened lids, large ears, flared nares, hypoplastic alae, short columella, protruding upper lip, and microretrognathia. There are also delayed closing of fontanels and broad great toes. Skin is characterized by redundancy or laxity with minimal subcutaneous fat, cutaneous capillary malformations, and very fine hair and eyebrows. Death results from cardiogenic shock following arrhythmia. {ECO:0000269|PubMed:21700266, ECO:0000269|PubMed:25489052, ECO:0000269|PubMed:26522270}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NATD; reduced N-terminal acetyltransferase activity; impaired interaction with NAA15 and NAA50; does not affect cytoplasmic localization.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  37
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  235
The length of the canonical sequence.

Location on the sequence:   CNLLCLPENYQMKYYFYHGL  S WPQLSYIAEDENGKIVGYVL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         CNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVL

Mouse                         CNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVL

Bovine                        CNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 235 N-alpha-acetyltransferase 10
Domain 1 – 152 N-acetyltransferase
Region 1 – 58 Interaction with NAA15


Literature citations

Using VAAST to identify an X-linked disorder resulting in lethality in male infants due to N-terminal acetyltransferase deficiency.
Rope A.F.; Wang K.; Evjenth R.; Xing J.; Johnston J.J.; Swensen J.J.; Johnson W.E.; Moore B.; Huff C.D.; Bird L.M.; Carey J.C.; Opitz J.M.; Stevens C.A.; Jiang T.; Schank C.; Fain H.D.; Robison R.; Dalley B.; Chin S.; South S.T.; Pysher T.J.; Jorde L.B.; Hakonarson H.; Lillehaug J.R.; Biesecker L.G.; Yandell M.; Arnesen T.; Lyon G.J.;
Am. J. Hum. Genet. 89:28-43(2011)
Cited for: VARIANT NATD PRO-37; CHARACTERIZATION OF VARIANT NATD PRO-37;

Biochemical and cellular analysis of Ogden syndrome reveals downstream Nt-acetylation defects.
Myklebust L.M.; Van Damme P.; Stoeve S.I.; Doerfel M.J.; Abboud A.; Kalvik T.V.; Grauffel C.; Jonckheere V.; Wu Y.; Swensen J.; Kaasa H.; Liszczak G.; Marmorstein R.; Reuter N.; Lyon G.J.; Gevaert K.; Arnesen T.;
Hum. Mol. Genet. 24:1956-1976(2015)
Cited for: VARIANT NATD PRO-37; CHARACTERIZATION OF VARIANT NATD PRO-37; FUNCTION; CATALYTIC ACTIVITY; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.