Home  |  Contact

UniProtKB/Swiss-Prot P37173: Variant p.Cys514Arg

TGF-beta receptor type-2
Gene: TGFBR2
Variant information

Variant position:  514
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Cysteine (C) to Arginine (R) at position 514 (C514R, p.Cys514Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In LDS2.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  514
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  567
The length of the canonical sequence.

Location on the sequence:   DRGRPEIPSFWLNHQGIQMV  C ETLTECWDHDPEARLTAQCV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCV

Mouse                         DRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCV

Rat                           DRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCV

Chicken                       DRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTAQCV

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 23 – 567 TGF-beta receptor type-2
Topological domain 188 – 567 Cytoplasmic
Domain 244 – 544 Protein kinase
Region 439 – 567 Sufficient for interaction with CLU
Alternative sequence 81 – 567 Missing. In isoform 3.
Helix 508 – 520


Literature citations

Clinical features and genetic analysis of Korean patients with Loeys-Dietz syndrome.
Yang J.H.; Ki C.S.; Han H.; Song B.G.; Jang S.Y.; Chung T.Y.; Sung K.; Lee H.J.; Kim D.K.;
J. Hum. Genet. 57:52-56(2012)
Cited for: VARIANTS LDS2 GLN-306 DELINS HIS-GLU; ARG-377; PHE-449 AND ARG-514;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.