Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P15884: Variant p.Gly358Val

Transcription factor 4
Gene: TCF4
Feedback?
Variant information Variant position: help 358 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Valine (V) at position 358 (G358V, p.Gly358Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In PTHS; also expressed in the nucleus with a pattern indistinguishable from the wild-type; does not have a major impact on homodimer formation; affects transcriptional activity in a context-dependent manner. Any additional useful information about the variant.


Sequence information Variant position: help 358 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 667 The length of the canonical sequence.
Location on the sequence: help NNSFSSNPSTPVGSPPSLSA G TAVWSRNGGQASSSPNYEGP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         NNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGP

                              NNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGP

Mouse                         NNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGP

Rat                           NNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 667 Transcription factor 4
Region 336 – 379 Disordered
Modified residue 372 – 372 Phosphoserine
Alternative sequence 357 – 357 Missing. In isoform E-.



Literature citations
Functional analysis of TCF4 missense mutations that cause Pitt-Hopkins syndrome.
Forrest M.; Chapman R.M.; Doyle A.M.; Tinsley C.L.; Waite A.; Blake D.J.;
Hum. Mutat. 33:1676-1686(2012)
Cited for: SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS PTHS VAL-358; GLY-535; PRO-574; TRP-576 AND VAL-610;
Further delineation of Pitt-Hopkins syndrome: phenotypic and genotypic description of 16 novel patients.
Zweier C.; Sticht H.; Bijlsma E.K.; Clayton-Smith J.; Boonen S.E.; Fryer A.; Greally M.T.; Hoffmann L.; den Hollander N.S.; Jongmans M.; Kant S.G.; King M.D.; Lynch S.A.; McKee S.; Midro A.T.; Park S.M.; Ricotti V.; Tarantino E.; Wessels M.; Peippo M.; Rauch A.;
J. Med. Genet. 45:738-744(2008)
Cited for: VARIANTS PTHS VAL-358; PRO-574 AND HIS-578;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.