UniProtKB/Swiss-Prot P84022: Variant p.Glu239Lys

Mothers against decapentaplegic homolog 3
Gene: SMAD3
Chromosomal location: 15q22.33
Variant information

Variant position:  239
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamate (E) to Lysine (K) at position 239 (E239K, p.Glu239Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (E) to large size and basic (K)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Loeys-Dietz syndrome 3 (LDS3) [MIM:613795]: An aortic aneurysm syndrome with widespread systemic involvement. The disorder is characterized by the triad of arterial tortuosity and aneurysms, hypertelorism, and bifid uvula or cleft palate. Patients with LDS3 also manifest early-onset osteoarthritis. They lack craniosynostosis and mental retardation. {ECO:0000269|PubMed:21217753, ECO:0000269|PubMed:21778426}. Note=The disease is caused by mutations affecting the gene represented in this entry. SMAD3 mutations have been reported to be also associated with thoracic aortic aneurysms and dissection (TAAD) (PubMed:21778426). This phenotype is distinguised from LDS3 by having aneurysms restricted to thoracic aorta. As individuals carrying these mutations also exhibit aneurysms of other arteries, including abdominal aorta, iliac, and/or intracranial arteries (PubMed:21778426), they have been classified as LDS3 by the OMIM resource. {ECO:0000269|PubMed:21778426}.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In LDS3.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  239
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  425
The length of the canonical sequence.

Location on the sequence:   LDLQPVTYCEPAFWCSISYY  E LNQRVGETFHASQPSMTVDG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDG

Mouse                         LDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDG

Rat                           LDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDG

Pig                           LDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDG

Chicken                       LDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 425 Mothers against decapentaplegic homolog 3
Domain 232 – 425 MH2
Beta strand 231 – 239


Literature citations

Exome sequencing identifies SMAD3 mutations as a cause of familial thoracic aortic aneurysm and dissection with intracranial and other arterial aneurysms.
Regalado E.S.; Guo D.C.; Villamizar C.; Avidan N.; Gilchrist D.; McGillivray B.; Clarke L.; Bernier F.; Santos-Cortez R.L.; Leal S.M.; Bertoli-Avella A.M.; Shendure J.; Rieder M.J.; Nickerson D.A.; Milewicz D.M.;
Circ. Res. 109:680-686(2011)
Cited for: VARIANTS LDS3 VAL-112; LYS-239 AND LYS-279;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.