Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y6K1: Variant p.Arg882Cys

DNA (cytosine-5)-methyltransferase 3A
Gene: DNMT3A
Feedback?
Variant information Variant position: help 882 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Cysteine (C) at position 882 (R882C, p.Arg882Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In TBRS and AML; somatic variant in AML. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 882 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 912 The length of the canonical sequence.
Location on the sequence: help TEMERVFGFPVHYTDVSNMS R LARQRLLGRSWSVPVIRHLF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF

Mouse                         TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF

Rat                           TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF

Chicken                       TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 912 DNA (cytosine-5)-methyltransferase 3A
Domain 634 – 912 SAM-dependent MTase C5-type
Alternative sequence 167 – 912 Missing. In isoform 3.
Helix 882 – 890



Literature citations
DNMT3A mutations in acute myeloid leukemia.
Ley T.J.; Ding L.; Walter M.J.; McLellan M.D.; Lamprecht T.; Larson D.E.; Kandoth C.; Payton J.E.; Baty J.; Welch J.; Harris C.C.; Lichti C.F.; Townsend R.R.; Fulton R.S.; Dooling D.J.; Koboldt D.C.; Schmidt H.; Zhang Q.; Osborne J.R.; Lin L.; O'Laughlin M.; McMichael J.F.; Delehaunty K.D.; McGrath S.D.; Fulton L.A.; Magrini V.J.; Vickery T.L.; Hundal J.; Cook L.L.; Conyers J.J.; Swift G.W.; Reed J.P.; Alldredge P.A.; Wylie T.; Walker J.; Kalicki J.; Watson M.A.; Heath S.; Shannon W.D.; Varghese N.; Nagarajan R.; Westervelt P.; Tomasson M.H.; Link D.C.; Graubert T.A.; DiPersio J.F.; Mardis E.R.; Wilson R.K.;
N. Engl. J. Med. 363:2424-2433(2010)
Cited for: INVOLVEMENT IN AML; VARIANTS AML HIS-882 AND CYS-882; Mutational spectrum analysis of chronic myelomonocytic leukemia includes genes associated with epigenetic regulation: UTX, EZH2, and DNMT3A.
Jankowska A.M.; Makishima H.; Tiu R.V.; Szpurka H.; Huang Y.; Traina F.; Visconte V.; Sugimoto Y.; Prince C.; O'Keefe C.; Hsi E.D.; List A.; Sekeres M.A.; Rao A.; McDevitt M.A.; Maciejewski J.P.;
Blood 118:3932-3941(2011)
Cited for: VARIANTS ASP-699; PHE-731 DEL; CYS-882; HIS-882 AND PRO-882; SETD2 and DNMT3A screen in the Sotos-like syndrome French cohort.
Tlemsani C.; Luscan A.; Leulliot N.; Bieth E.; Afenjar A.; Baujat G.; Doco-Fenzy M.; Goldenberg A.; Lacombe D.; Lambert L.; Odent S.; Pasche J.; Sigaudy S.; Buffet A.; Violle-Poirsier C.; Briand-Suleau A.; Laurendeau I.; Chin M.; Saugier-Veber P.; Vidaud D.; Cormier-Daire V.; Vidaud M.; Pasmant E.; Burglen L.;
J. Med. Genet. 53:743-751(2016)
Cited for: VARIANTS TBRS CYS-365; ASN-529; GLY-778 AND CYS-882; The spectrum of DNMT3A variants in Tatton-Brown-Rahman syndrome overlaps with that in hematologic malignancies.
Shen W.; Heeley J.M.; Carlston C.M.; Acuna-Hidalgo R.; Nillesen W.M.; Dent K.M.; Douglas G.V.; Levine K.L.; Bayrak-Toydemir P.; Marcelis C.L.; Shinawi M.; Carey J.C.;
Am. J. Med. Genet. A 173:3022-3028(2017)
Cited for: VARIANTS TBRS CYS-882 AND HIS-882; Acute myeloid leukaemia in a case with Tatton-Brown-Rahman syndrome: the peculiar DNMT3A R882 mutation.
Hollink I.H.I.M.; van den Ouweland A.M.W.; Beverloo H.B.; Arentsen-Peters S.T.C.J.M.; Zwaan C.M.; Wagner A.;
J. Med. Genet. 54:805-808(2017)
Cited for: VARIANT TBRS CYS-882;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.