Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot O60931: Variant p.Tyr173Cys

Cystinosin
Gene: CTNS
Chromosomal location: 17p13
Variant information

Variant position:  173
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Tyrosine (Y) to Cysteine (C) at position 173 (Y173C, p.Tyr173Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and aromatic (Y) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cystinosis, nephropathic type (CTNS) [MIM:219800]: A form of cystinosis, a lysosomal storage disease due to defective transport of cystine across the lysosomal membrane. This results in cystine accumulation and crystallization in the cells causing widespread tissue damage. The classical nephropathic form has onset in the first year of life and is characterized by a polyuro-polydipsic syndrome, marked height-weight growth delay, generalized impaired proximal tubular reabsorptive capacity, with severe fluid-electrolyte balance alterations, renal failure, ocular symptoms and other systemic complications. {ECO:0000269|PubMed:10482956, ECO:0000269|PubMed:10556299, ECO:0000269|PubMed:12204010, ECO:0000269|PubMed:12442267, ECO:0000269|PubMed:12825071, ECO:0000269|PubMed:19852576, ECO:0000269|PubMed:21786142, ECO:0000269|PubMed:22450360, ECO:0000269|PubMed:9792862}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CTNS.
Any additional useful information about the variant.



Sequence information

Variant position:  173
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  367
The length of the canonical sequence.

Location on the sequence:   KSVIGLSFDFVALNLTGFVA  Y SVFNIGLLWVPYIKEQFLLK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLK

Mouse                         KSVIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLK

Bovine                        KSVVGLSFDFVVLNLMGFVAYSVFNIGLFWVPSIKEQFLLK

Caenorhabditis elegans        KSVVGLNFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIV

Drosophila                    KSVEGLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNEYEVR

Slime mold                    KNVIGLSFDFLLFNITGYACYSVFNSVLYFDKLVKNEYYDK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 367 Cystinosin
Transmembrane 162 – 182 Helical
Domain 123 – 189 PQ-loop 1


Literature citations

Genetic basis of cystinosis in Turkish patients: a single-center experience.
Topaloglu R.; Vilboux T.; Coskun T.; Ozaltin F.; Tinloy B.; Gunay-Aygun M.; Bakkaloglu A.; Besbas N.; van den Heuvel L.; Kleta R.; Gahl W.A.;
Pediatr. Nephrol. 27:115-121(2012)
Cited for: VARIANTS CTNS GLY-151; ASP-157 AND CYS-173;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.