Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13485: Variant p.Ile500Thr

SMAD family member 4
Gene: SMAD4
Feedback?
Variant information Variant position: help 500 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Isoleucine (I) to Threonine (T) at position 500 (I500T, p.Ile500Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MYHRS; there is an enhanced levels of SMAD4 protein with lower levels of ubiquitinated SMAD4 fibroblasts compared to controls suggesting stabilization of the mutant protein; 8-fold increase in phosphorylated SMAD2 and SMAD3; 11-fold increase in phosphorylated SMAD1, SMAD5 and SMAD8 in cell nuclei compared to controls. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 500 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 552 The length of the canonical sequence.
Location on the sequence: help PAISLSAAAGIGVDDLRRLC I LRMSFVKGWGPDYPRQSIKE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE

Mouse                         PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE

Rat                           PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE

Pig                           PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE

Bovine                        PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE

Drosophila                    --RSMTAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 552 SMAD family member 4
Domain 323 – 552 MH2
Site 515 – 515 Necessary for heterotrimerization
Modified residue 507 – 507 N6-acetyllysine
Cross 519 – 519 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis 496 – 496 R -> S. No effect on heterotrimerization. Partially diminished transcriptional activation.
Mutagenesis 502 – 502 R -> S. No effect on heterotrimerization. Greatly reduced transcriptional activation.
Mutagenesis 515 – 515 R -> S. Reduced heterotrimerization.
Mutagenesis 519 – 519 K -> R. Abolishes ubiquitination.
Beta strand 500 – 506



Literature citations
A restricted spectrum of mutations in the SMAD4 tumor-suppressor gene underlies Myhre syndrome.
Caputo V.; Cianetti L.; Niceta M.; Carta C.; Ciolfi A.; Bocchinfuso G.; Carrani E.; Dentici M.L.; Biamino E.; Belligni E.; Garavelli L.; Boccone L.; Melis D.; Andria G.; Gelb B.D.; Stella L.; Silengo M.; Dallapiccola B.; Tartaglia M.;
Am. J. Hum. Genet. 90:161-169(2012)
Cited for: VARIANTS MYHRS THR-500 AND VAL-500;
Mutations at a single codon in Mad homology 2 domain of SMAD4 cause Myhre syndrome.
Le Goff C.; Mahaut C.; Abhyankar A.; Le Goff W.; Serre V.; Afenjar A.; Destree A.; di Rocco M.; Heron D.; Jacquemont S.; Marlin S.; Simon M.; Tolmie J.; Verloes A.; Casanova J.L.; Munnich A.; Cormier-Daire V.;
Nat. Genet. 44:85-88(2012)
Cited for: VARIANTS MYHRS MET-500; THR-500 AND VAL-500; CHARACTERIZATION OF VARIANT MYHRS THR-500;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.