UniProtKB/Swiss-Prot Q9BWX5: Variant p.Gly184Val

Transcription factor GATA-5
Gene: GATA5
Chromosomal location: 20q13.33
Variant information

Variant position:  184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glycine (G) to Valine (V) at position 184 (G184V, p.Gly184Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to medium size and hydrophobic (V)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In CHTD5; unknown pathological significance.
Any additional useful information about the variant.



Sequence information

Variant position:  184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  397
The length of the canonical sequence.

Location on the sequence:   LHGLPGRRPTFVSDFLEEFP  G EGRECVNCGALSTPLWRRDG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LH-------GLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDG

Mouse                         LHGLQARPGGLPGRRTSFVPDFLEEFPGEGRECVNCGALST

Bovine                        LHSLQGLPAGLPGRRAPFAAELLEEFPGEGRECVNCGALST

Chicken                       LHSLQTRQAALPGRRSTF--EYLEEFPGDGRECVNCGAMST

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 397 Transcription factor GATA-5


Literature citations

Mutational spectrum of the GATA5 gene associated with familial atrial fibrillation.
Yang Y.Q.; Wang J.; Wang X.H.; Wang Q.; Tan H.W.; Zhang M.; Shen F.F.; Jiang J.Q.; Fang W.Y.; Liu X.;
Int. J. Cardiol. 157:305-307(2012)
Cited for: INVOLVEMENT IN CHTD5; VARIANTS CHTD5 VAL-184; THR-218 AND PRO-266;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.