Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q76LX8: Variant p.Leu232Gln

A disintegrin and metalloproteinase with thrombospondin motifs 13
Gene: ADAMTS13
Feedback?
Variant information Variant position: help 232 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Leucine (L) to Glutamine (Q) at position 232 (L232Q, p.Leu232Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (L) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In TTP. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 232 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1427 The length of the canonical sequence.
Location on the sequence: help EDTGFDLGVTIAHEIGHSFG L EHDGAPGSGCGPSGHVMASD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EDTGFDLGVTIAHEIGHSFGLEHDGAPGSG--CGPSGHVMASD

Mouse                         EDTGFDLGVTIAHEIGHSFGLDHDGAPGSGSTCKASGHVMA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 75 – 1427 A disintegrin and metalloproteinase with thrombospondin motifs 13
Domain 80 – 286 Peptidase M12B
Active site 225 – 225
Binding site 212 – 212
Binding site 224 – 224
Binding site 228 – 228
Binding site 234 – 234
Disulfide bond 202 – 281
Alternative sequence 2 – 329 Missing. In isoform 4.
Mutagenesis 212 – 212 E -> A. Dramatically reduced affinity for calcium.
Helix 232 – 234



Literature citations
von Willebrand factor cleaving protease and ADAMTS13 mutations in childhood TTP.
Schneppenheim R.; Budde U.; Oyen F.; Angerhaus D.; Aumann V.; Drewke E.; Hassenpflug W.; Haberle J.; Kentouche K.; Kohne E.; Kurnik K.; Mueller-Wiefel D.; Obser T.; Santer R.; Sykora K.W.;
Blood 101:1845-1850(2003)
Cited for: VARIANTS TTP GLN-232; CYS-263 AND LEU-353;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.