Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y5Q5: Variant p.Lys317Glu

Atrial natriuretic peptide-converting enzyme
Gene: CORIN
Feedback?
Variant information Variant position: help 317 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Lysine (K) to Glutamate (E) at position 317 (K317E, p.Lys317Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (K) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In PEE5. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 317 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1042 The length of the canonical sequence.
Location on the sequence: help DWSDEAHCNCSENLFHCHTG K CLNYSLVCDGYDDCGDLSDE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         DWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDE

Mouse                         DWSDEAHCNCSKDLFHCGTGKCLHYSLLCDGYDDCGDLSDE

Rat                           DWSDEAHCNCSEDLFHCGTGKCLHHSLVCDGYDDCGDLSDE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1042 Atrial natriuretic peptide-converting enzyme
Chain 1 – 801 Atrial natriuretic peptide-converting enzyme, N-terminal propeptide
Chain 165 – 801 Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment
Topological domain 67 – 1042 Extracellular
Domain 305 – 340 LDL-receptor class A 2
Glycosylation 305 – 305 N-linked (GlcNAc...) asparagine
Glycosylation 320 – 320 N-linked (GlcNAc...) asparagine
Disulfide bond 306 – 318
Disulfide bond 313 – 331



Literature citations
Role of corin in trophoblast invasion and uterine spiral artery remodelling in pregnancy.
Cui Y.; Wang W.; Dong N.; Lou J.; Srinivasan D.K.; Cheng W.; Huang X.; Liu M.; Fang C.; Peng J.; Chen S.; Wu S.; Liu Z.; Dong L.; Zhou Y.; Wu Q.;
Nature 484:246-250(2012)
Cited for: FUNCTION; INVOLVEMENT IN PEE5; TISSUE SPECIFICITY; VARIANTS PEE5 GLU-317 AND GLY-472;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.