Home  |  Contact

UniProtKB/Swiss-Prot O75190: Variant p.Phe89Ile

DnaJ homolog subfamily B member 6
Gene: DNAJB6
Variant information

Variant position:  89
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Phenylalanine (F) to Isoleucine (I) at position 89 (F89I, p.Phe89Ile).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and aromatic (F) to medium size and hydrophobic (I)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Muscular dystrophy, limb-girdle, autosomal dominant 1 (LGMDD1) [MIM:603511]: An autosomal dominant myopathy characterized by adult onset of proximal muscle weakness, beginning in the hip girdle region and later progressing to the shoulder girdle region. {ECO:0000269|PubMed:22334415, ECO:0000269|PubMed:22366786}. Note=The disease is caused by mutations affecting the gene represented in this entry. There is evidence that LGMDD1 is caused by dysfunction of isoform B (PubMed:22366786). {ECO:0000269|PubMed:22366786}.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In LGMDD1; the mutation results in inefficient inhibition of protein aggregation by isoform B.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  89
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  326
The length of the canonical sequence.

Location on the sequence:   GKEGLNGGGGGGSHFDSPFE  F GFTFRNPDDVFREFFGGRDP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GKEGLN-GGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDP

Mouse                         GKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREFFGGRD

Rat                           GKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRD

Bovine                        GKEGLN-GGGGGGSHFDSPFEFGFTFRNPEDVFREFFGGRD

Chicken                       GKEGLI-NGGGGGSHHDNPFEFGFTFRNPDDVFREFFGGRD

Xenopus tropicalis            GKEGLT--GGGGGSHFDNPYEFGFTFRSPDDVFRDFFGGRD

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 326 DnaJ homolog subfamily B member 6
Region 2 – 146 Interaction with HSP70
Compositional bias 83 – 172 Gly/Phe-rich


Literature citations

Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy.
Sarparanta J.; Jonson P.H.; Golzio C.; Sandell S.; Luque H.; Screen M.; McDonald K.; Stajich J.M.; Mahjneh I.; Vihola A.; Raheem O.; Penttila S.; Lehtinen S.; Huovinen S.; Palmio J.; Tasca G.; Ricci E.; Hackman P.; Hauser M.; Katsanis N.; Udd B.;
Nat. Genet. 44:450-455(2012)
Cited for: FUNCTION IN INHIBITION OF HUNTINGTIN AGGREGATION; SUBUNIT; INTERACTION WITH BAG3; HSPB8 AND STUB1; TISSUE SPECIFICITY; SUBCELLULAR LOCATION; VARIANTS LGMDD1 ILE-89 AND LEU-93; CHARACTERIZATION OF VARIANTS LGMDD1 ILE-89 AND LEU-93;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.