Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00754: Variant p.Gly451Cys

Lysosomal alpha-mannosidase
Gene: MAN2B1
Feedback?
Variant information Variant position: help 451 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Cysteine (C) at position 451 (G451C, p.Gly451Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MANSA; reduced enzyme activity; protein localizes to the lysosome. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 451 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1011 The length of the canonical sequence.
Location on the sequence: help GDSAPLNEAMAVLQHHDAVS G TSRQHVANDYARQLAAGWGP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGP

Mouse                         GDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGP

Bovine                        GDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEGWRP

Cat                           GDSAPLNEAMAVLQHHDAVSGTSKQHVADDYARQLAAGWDP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 50 – 1011 Lysosomal alpha-mannosidase
Chain 430 – 601 Lysosomal alpha-mannosidase C peptide
Binding site 446 – 446



Literature citations
Molecular and cellular characterization of novel {alpha}-mannosidosis mutations.
Kuokkanen E.; Riise Stensland H.M.; Smith W.; Kjeldsen Buvang E.; Van Nguyen L.; Nilssen O.; Heikinheimo P.;
Hum. Mol. Genet. 20:2651-2661(2011)
Cited for: CHARACTERIZATION OF VARIANTS MANSA PHE-55; GLU-74; PRO-95; HIS-99; ASN-159; ARG-197; LEU-200; ASN-200; PRO-202; TRP-229; LEU-263; LEU-318; PRO-352; LEU-379; CYS-390; VAL-420; TYR-445; CYS-451; PHE-453; TYR-453; GLU-457; SER-501; PRO-565; ARG-745; ARG-800; TRP-800; HIS-ARG-815 INS; ARG-891; PRO-892; CYS-916; HIS-916; PRO-950; ARG-956 AND SER-1000; SUBCELLULAR LOCATION;
Identification of 83 novel alpha-mannosidosis-associated sequence variants: functional analysis of MAN2B1 missense mutations.
Riise Stensland H.M.; Klenow H.B.; Van Nguyen L.; Hansen G.M.; Malm D.; Nilssen O.;
Hum. Mutat. 33:511-520(2012)
Cited for: VARIANTS MANSA PHE-55; GLU-74; PRO-95; HIS-99; ASN-159; ARG-197; ASN-200; LEU-200; PRO-202; TRP-229; LEU-263; LEU-318; 339-VAL--GLN-342 DEL; PRO-352; LEU-379; CYS-390; LYS-402; VAL-420; TYR-445; CYS-451; TYR-453; PHE-453; GLU-457; SER-501; PRO-565; ARG-745; ARG-800; TRP-800; HIS-ARG-815 INS; ARG-891; PRO-892; CYS-916; HIS-916; PRO-950; ARG-956 AND SER-1000; VARIANTS LEU-248; VAL-278; SER-282; ILE-312; GLN-337; SER-413; SER-481 AND LEU-669; CHARACTERIZATION OF VARIANTS MANSA PHE-55; GLU-74; PRO-95; HIS-99; ASN-159; ARG-197; ASN-200; LEU-200; PRO-202; TRP-229; LEU-263; LEU-318; PRO-352; LEU-379; CYS-390; LYS-402; VAL-420; TYR-445; CYS-451; TYR-453; PHE-453; GLU-457; SER-501; PRO-565; ARG-745; ARG-800; TRP-800; HIS-ARG-815 INS; ARG-891; PRO-892; CYS-916; HIS-916; PRO-950; ARG-956 AND SER-1000;
Alpha-mannosidosis: correlation between phenotype, genotype and mutant MAN2B1 subcellular localisation.
Borgwardt L.; Stensland H.M.; Olsen K.J.; Wibrand F.; Klenow H.B.; Beck M.; Amraoui Y.; Arash L.; Fogh J.; Nilssen O.; Dali C.I.; Lund A.M.;
Orphanet J. Rare Dis. 10:70-70(2015)
Cited for: VARIANTS MANSA PHE-55; 77-TRP--GLY-1011 DEL; PRO-95; ASN-102; 128-TRP--GLY-1011 DEL; 140-ARG--GLY-1011 DEL; VAL-153; ARG-197; ASN-200; LEU-200; TRP-229; 261-TYR--GLY-1011 DEL; LEU-263; LEU-318; PRO-352; TYR-445; CYS-451; PHE-453; GLU-457; 461-TYR--GLY-1011 DEL; SER-501; ARG-745; TRP-750; 751-GLU--GLY-1011 DEL; 767-GLN--GLY-1011 DEL; ARG-800; TRP-800; PRO-809; HIS-ARG-815 INS; 908-TRP--GLY-1011 DEL; PRO-950 AND HIS-962; CHARACTERIZATION OF VARIANTS PRO-95; ASN-102; VAL-153; PRO-352; TYR-445; PHE-453; ARG-745; TRP-750 AND HIS-962; CATALYTIC ACTIVITY; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.