UniProtKB/Swiss-Prot P16220: Variant p.Asp102Gly

Cyclic AMP-responsive element-binding protein 1
Gene: CREB1
Feedback?

Variant information Variant position:

102 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Aspartate (D) to Glycine (G) at position 102 (D102G, p.Asp102Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and acidic (D) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in a patient with multiple congenital anomalies; does not affect CREB1 phosphorylation at S-119; fails to interact with CREBBP. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs387906617 [ dbSNP | Ensembl ]

Sequence information Variant position:

102 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

327 The length of the canonical sequence.
Location on the sequence:

QVQTVQISTIAESEDSQESV D SVTDSQKRREILSRRPSYRK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         QVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK

Mouse                         QVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK

Rat                           QVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK

Bovine                        QVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 327	Cyclic AMP-responsive element-binding protein 1
Domain	87 – 146	KID
Region	94 – 113	Disordered
Modified residue	119 – 119	Phosphoserine; by CaMK1, CaMK2, CaMK4, PKB/AKT1 or PKB/AKT2, RPS6KA3, RPS6KA4, RPS6KA5, SGK1 and TSSK4
Cross	122 – 122	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Alternative sequence	86 – 86	V -> VQSSCKDLKRLFSGT. In isoform 2 and isoform 3.
Mutagenesis	119 – 119	S -> A. Does not interact with TOX3 and inhibits induction of transcription by TOX3. Loss of phosphorylation by CaMK4. Loss of phosphorylation by TSSK4.

Literature citations
A p.D116G mutation in CREB1 leads to novel multiple malformation syndrome resembling CrebA knockout mouse.
Kitazawa S.; Kondo T.; Mori K.; Yokoyama N.; Matsuo M.; Kitazawa R.;
Hum. Mutat. 33:651-654(2012)
Cited for: POSSIBLE INVOLVEMENT IN MULTIPLE CONGENITAL ANOMALIES; VARIANT GLY-102; CHARACTERIZATION OF VARIANT GLY-102;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.